Resistance mutation info of target
| Target General Information | |||||
|---|---|---|---|---|---|
| Target ID | T79068 | ||||
| Target Name | Bacterial Enoyl-[acyl-carrier-protein] reductase [NADH] (Inha) | Target Info | |||
| Gene Name | inhA | ||||
| Species | Mycobacterium tuberculosis | ||||
| Uniprot ID | INHA_MYCTU | ||||
| Sequence | MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK TVCALLSDWLPATTGDIIYADGGAHTQLL [Mycobacterium tuberculosis] |
||||
| Drug Resistance Mutation and Corresponding Drugs | |||||
| Mutation Info | Missense: E217D | ||||
| Mutation Info | Missense: I16T | ||||
| Mutation Info | Missense: I194T | ||||
| Mutation Info | Missense: I21T | ||||
| Mutation Info | Missense: I21V | ||||
| Mutation Info | Missense: I47T | ||||
| Mutation Info | Missense: I95P | ||||
| Mutation Info | Missense: I95T | ||||
| Mutation Info | Missense: K8N | ||||
| Mutation Info | Missense: R202G | ||||
| Mutation Info | Missense: S94A | ||||
| Mutation Info | Missense: S94L | ||||
| Mutation Info | Missense: V78A | ||||
| Reference | |||||
| Ref 555461 | Molecular genetic basis of antimicrobial agent resistance in Mycobacterium tuberculosis: 1998 update. Tuber Lung Dis. 1998;79(1):3-29. | ||||
| Ref 555471 | Exclusive mutations related to isoniazid and ethionamide resistance among Mycobacterium tuberculosis isolates from Korea. Int J Tuberc Lung Dis. 2000 May;4(5):441-7. | ||||
| Ref 555529 | ethA, inhA, and katG loci of ethionamide-resistant clinical Mycobacterium tuberculosis isolates. Antimicrob Agents Chemother. 2003 Dec;47(12):3799-805. | ||||
| Ref 555587 | Molecular characterization of isoniazid resistance in Mycobacterium tuberculosis: identification of a novel mutation in inhA. Antimicrob Agents Chemother. 2006 Mar;50(3):1075-8. | ||||
| Ref 555604 | Transfer of a point mutation in Mycobacterium tuberculosis inhA resolves the target of isoniazid. Nat Med. 2006 Sep;12(9):1027-9. Epub 2006 Aug 13. | ||||
| Ref 555711 | Performance assessment of the GenoType MTBDRplus test and DNA sequencing in detection of multidrug-resistant Mycobacterium tuberculosis. J Clin Microbiol. 2009 Aug;47(8):2520-4. doi: 10.1128/JCM.02499-08. Epub 2009 Jun 3. | ||||
| Ref 556243 | CARD 2017: expansion and model-centric curation of the comprehensive antibiotic resistance database. Nucleic Acids Res. 2017 Jan 4;45(D1):D566-D573. doi: 10.1093/nar/gkw1004. Epub 2016 Oct 26. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

