Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T64591
|
||||
| Former ID |
TTDS00399
|
||||
| Target Name |
5-hydroxytryptamine receptor 3A
|
||||
| Gene Name |
HTR3A
|
||||
| Synonyms |
5-HT-3; 5-HT3A; 5-HT3R; 5HT3R; HTR3; Serotonin receptor 3A; Serotonin-gated ion channel receptor; HTR3A
|
||||
| Target Type |
Successful
|
||||
| Disease | Emesis [ICD9: 787; ICD10: R11] | ||||
| Fibromyalgia [ICD9: 729.1; ICD10: M79.7] | |||||
| Gastroesophageal reflux disease [ICD9: 140-229, 530; ICD10: K21] | |||||
| Irritable bowel syndrome [ICD9: 564.1, 787.91; ICD10: A09, K58, K59.1] | |||||
| Local anaesthetic [ICD10: R20.0] | |||||
| Nausea; Vomiting [ICD9: 787, 787.0; ICD10: R11] | |||||
| Nausea [ICD10: R11] | |||||
| Function |
This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which whenactivated causes fast, depolarizing responses in neurons. It is a cation-specific, but otherwise relatively nonselective, ion channel.
|
||||
| BioChemical Class |
Neurotransmitter receptor
|
||||
| Target Validation |
T64591
|
||||
| UniProt ID | |||||
| Sequence |
MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Alosetron | Drug Info | Approved | Irritable bowel syndrome | [536224], [539447] |
| Dolasetron | Drug Info | Approved | Nausea; Vomiting | [536361] | |
| Levetriacetam | Drug Info | Approved | Fibromyalgia | [536647] | |
| Palonosetron | Drug Info | Approved | Nausea; Vomiting | [536361], [542509] | |
| Procaine | Drug Info | Approved | Local anaesthetic | [551871] | |
| Tropisetron | Drug Info | Approved | Fibromyalgia | [536647], [539678] | |
| Cilansetron | Drug Info | Phase 3 | Irritable bowel syndrome | [536224], [539448] | |
| ATI-17000 | Drug Info | Preclinical | Irritable bowel syndrome | [536224] | |
| BEMESETRON | Drug Info | Discontinued in Phase 3 | Discovery agent | [544703] | |
| Norcisapride | Drug Info | Discontinued in Phase 2 | Gastroesophageal reflux disease | [546263] | |
| YM-114 | Drug Info | Discontinued in Phase 2 | Nausea | [545300] | |
| AS-8112 | Drug Info | Terminated | Emesis | [546591] | |
| Inhibitor | (4-Quinolin-2-ylpiperazin-1-yl)acetic Acid | Drug Info | [530114] | ||
| 1-(biphenyl-4-yl)-3-(4-(piperidin-1-yl)butyl)urea | Drug Info | [530912] | |||
| 10,11-dihydro-5H-dibenzo[b,f]azepine | Drug Info | [529922] | |||
| 2-(1H-Imidazol-4-ylmethyl)-4-phenyl-thiazole | Drug Info | [532034] | |||
| 2-(4-Benzyl-piperazin-1-yl)-benzothiazole | Drug Info | [533917] | |||
| 2-(4-Methyl-piperazin-1-yl)-quinoline | Drug Info | [525484] | |||
| 3-(2-Amino-ethyl)-2-methyl-1H-indol-5-ol | Drug Info | [532034] | |||
| 3alpha-(1'-Methyl-2'-Indolecarbonyloxy)-tropane | Drug Info | [530355] | |||
| 3alpha-(2'-Indolecarbonyloxy)-nortropane | Drug Info | [530355] | |||
| 4-((naphthalen-2-yloxy)methyl)piperidine | Drug Info | [530012] | |||
| 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
| 4-Benzoxazo-2-yl-1,4-diazabicyclo[3.2.2]nonane | Drug Info | [530609] | |||
| 5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| 5-chloro-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| 6-(4-Methyl-piperazin-1-yl)-phenanthridine | Drug Info | [525484] | |||
| 7-(piperidin-4-ylmethoxy)-2-naphthonitrile | Drug Info | [530012] | |||
| A-987306 | Drug Info | [529789] | |||
| BEMESETRON | Drug Info | [528702] | |||
| BRL-24682 | Drug Info | [526544] | |||
| CP-810123 | Drug Info | [530609] | |||
| FLUPENTIXOLE | Drug Info | [529922] | |||
| MESULERGINE | Drug Info | [534503] | |||
| Norcisapride | Drug Info | [530330] | |||
| PH-709829 | Drug Info | [529479] | |||
| QUIPAZINE | Drug Info | [530451] | |||
| SEROTONIN | Drug Info | [525484] | |||
| Antagonist | (S)-zacopride | Drug Info | [526116] | ||
| Alosetron | Drug Info | [537217], [537382] | |||
| AS-8112 | Drug Info | [536188] | |||
| ATI-17000 | Drug Info | [536224] | |||
| Dolasetron | Drug Info | [537011] | |||
| Levetriacetam | Drug Info | [536647] | |||
| Palonosetron | Drug Info | [537311] | |||
| Procaine | Drug Info | [536543] | |||
| Tropisetron | Drug Info | [536647] | |||
| YM-114 | Drug Info | [534150], [551871] | |||
| [3H](S)-zacopride | Drug Info | [534304] | |||
| [3H]GR65630 | Drug Info | [528958] | |||
| [3H]granisetron | Drug Info | [534215] | |||
| [3H]LY278584 | Drug Info | [534033] | |||
| [3H]ramosetron | Drug Info | [533639] | |||
| Agonist | 1-phenylbiguanide | Drug Info | [533742] | ||
| 2-methyl-5-HT | Drug Info | [525930] | |||
| meta-chlorphenylbiguanide | Drug Info | [534584] | |||
| [3H]meta-chlorophenylbiguanide | Drug Info | [534584] | |||
| Modulator (allosteric modulator) | 5-hydroxyindole | Drug Info | [529253] | ||
| trichloroethanol | Drug Info | [529227] | |||
| Blocker (channel blocker) | bilobalide | Drug Info | [531440] | ||
| TMB-8 | Drug Info | [525521] | |||
| Modulator | Cilansetron | Drug Info | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Serotonergic synapse | ||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| PANTHER Pathway | 5HT3 type receptor mediated signaling pathway | ||||
| Reactome | Ligand-gated ion channel transport | ||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Iron uptake and transport | |||||
| References | |||||
| Ref 536224 | Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 539447 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2296). | ||||
| Ref 539448 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2297). | ||||
| Ref 539678 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 260). | ||||
| Ref 542509 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7486). | ||||
| Ref 544703 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000675) | ||||
| Ref 545300 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002741) | ||||
| Ref 546263 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007174) | ||||
| Ref 525484 | J Med Chem. 1999 May 6;42(9):1556-75.Novel potent and selective central 5-HT3 receptor ligands provided with different intrinsic efficacy. 2. Molecular basis of the intrinsic efficacy of arylpiperazine derivatives at the central 5-HT3 receptors. | ||||
| Ref 525521 | Characterization of interaction of 3,4,5-trimethoxybenzoic acid 8-(diethylamino)octyl ester with Torpedo californica nicotinic acetylcholine receptor and 5-hydroxytryptamine3 receptor. J Pharmacol Exp Ther. 1999 Jul;290(1):129-35. | ||||
| Ref 525930 | Pharmacological profile of YM-31636, a novel 5-HT3 receptor agonist, in vitro. Eur J Pharmacol. 2000 Dec 8;409(2):195-201. | ||||
| Ref 526116 | Pharmacological comparison of human homomeric 5-HT3A receptors versus heteromeric 5-HT3A/3B receptors. Neuropharmacology. 2001 Aug;41(2):282-4. | ||||
| Ref 526544 | J Med Chem. 2003 Feb 27;46(5):702-15.Synthesis and structure-affinity relationships of novel N-(1-ethyl-4-methylhexahydro-1,4-diazepin-6-yl)pyridine-3-carboxamides with potent serotonin 5-HT3 and dopamine D2 receptor antagonistic activity. | ||||
| Ref 528702 | J Med Chem. 1992 Jan 24;35(2):310-9.Zatosetron, a potent, selective, and long-acting 5HT3 receptor antagonist: synthesis and structure-activity relationships. | ||||
| Ref 528958 | Evaluation of the pharmacological profile of ramosetron, a novel therapeutic agent for irritable bowel syndrome. J Pharmacol Sci. 2007 Jul;104(3):263-73. | ||||
| Ref 529148 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. Epub 2007 Oct 30.Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. | ||||
| Ref 529227 | Arginine 246 of the pretransmembrane domain 1 region alters 2,2,2-trichloroethanol action in the 5-hydroxytryptamine3A receptor. J Pharmacol Exp Ther. 2008 Mar;324(3):1011-8. Epub 2007 Dec 19. | ||||
| Ref 529253 | The 5-HT3B subunit confers spontaneous channel opening and altered ligand properties of the 5-HT3 receptor. J Biol Chem. 2008 Mar 14;283(11):6826-31. | ||||
| Ref 529479 | Bioorg Med Chem Lett. 2008 Jun 15;18(12):3611-5. Epub 2008 May 1.Discovery of N-[(3R,5R)-1-azabicyclo[3.2.1]oct-3-yl]furo[2,3-c]pyridine-5-carboxamide as an agonist of the alpha7 nicotinic acetylcholine receptor: in vitro and in vivo activity. | ||||
| Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
| Ref 529922 | Eur J Med Chem. 2009 Jun;44(6):2667-72. Epub 2008 Dec 16.Molecular properties of psychopharmacological drugs determining non-competitive inhibition of 5-HT3A receptors. | ||||
| Ref 530012 | Bioorg Med Chem Lett. 2009 Apr 15;19(8):2329-32. Epub 2009 Feb 20.Design and optimization of selective serotonin re-uptake inhibitors with high synthetic accessibility. Part 1. | ||||
| Ref 530114 | J Med Chem. 2009 Jun 11;52(11):3548-62.Specific targeting of peripheral serotonin 5-HT(3) receptors. Synthesis, biological investigation, and structure-activity relationships. | ||||
| Ref 530330 | Bioorg Med Chem Lett. 2009 Oct 1;19(19):5679-83. Epub 2009 Aug 8.mu-Opioid/5-HT4 dual pharmacologically active agents-efforts towards an effective opioid analgesic with less GI and respiratory side effects (Part I). | ||||
| Ref 530355 | Bioorg Med Chem. 2009 Oct 1;17(19):6872-8. Epub 2009 Aug 20.Synthesis of heteroaromatic tropeines and heterogeneous binding to glycine receptors. | ||||
| Ref 530451 | J Med Chem. 2009 Nov 12;52(21):6946-50.Novel, potent, and selective quinoxaline-based 5-HT(3) receptor ligands. 1. Further structure-activity relationships and pharmacological characterization. | ||||
| Ref 530609 | J Med Chem. 2010 Feb 11;53(3):1222-37.Discovery of 4-(5-methyloxazolo[4,5-b]pyridin-2-yl)-1,4-diazabicyclo[3.2.2]nonane (CP-810,123), a novel alpha 7 nicotinic acetylcholine receptor agonist for the treatment of cognitive disorders in schizophrenia: synthesis, SAR development, and in vivo efficacy in cognition models. | ||||
| Ref 530912 | J Med Chem. 2010 Jun 10;53(11):4379-89.Novel alpha-7 nicotinic acetylcholine receptor agonists containing a urea moiety: identification and characterization of the potent, selective, and orally efficacious agonist 1-[6-(4-fluorophenyl)pyridin-3-yl]-3-(4-piperidin-1-ylbutyl) urea (SEN34625/WYE-103914). | ||||
| Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
| Ref 531440 | Binding sites for bilobalide, diltiazem, ginkgolide, and picrotoxinin at the 5-HT3 receptor. Mol Pharmacol. 2011 Jul;80(1):183-90. | ||||
| Ref 532034 | J Med Chem. 1990 Jan;33(1):13-6.Aromatic thiazole derivatives: structurally novel and selective serotonin-3 receptor antagonists. | ||||
| Ref 533639 | Molecular cloning of human 5-hydroxytryptamine3 receptor: heterogeneity in distribution and function among species. Mol Pharmacol. 1995 Sep;48(3):407-16. | ||||
| Ref 533742 | Allosteric interactions among agonists and antagonists at 5-hydroxytryptamine3 receptors. J Neurochem. 1995 Jul;65(1):104-10. | ||||
| Ref 533917 | J Med Chem. 1994 Apr 29;37(9):1320-5.Synthesis of 2-piperazinylbenzothiazole and 2-piperazinylbenzoxazole derivatives with 5-HT3 antagonist and 5-HT4 agonist properties. | ||||
| Ref 534033 | Pharmacological and regional characterization of [3H]LY278584 binding sites in human brain. J Neurochem. 1993 Feb;60(2):730-7. | ||||
| Ref 534150 | Effect of serotonin (5-HT)3-receptor antagonists YM060, YM114 (KAE-393), ondansetron and granisetron on 5-HT4 receptors and gastric emptying in rodents. Jpn J Pharmacol. 1995 Nov;69(3):205-14. | ||||
| Ref 534215 | Characterization of a human 5-hydroxytryptamine3 receptor type A (h5-HT3R-AS) subunit stably expressed in HEK 293 cells. Br J Pharmacol. 1996 Jul;118(5):1237-45. | ||||
| Ref 534304 | Autoradiographic distribution of [3H]-(S)-zacopride-labelled 5-HT3 receptors in human brain. J Neurol Sci. 1996 Dec;144(1-2):119-27. | ||||
| Ref 534503 | J Med Chem. 1997 Oct 24;40(22):3670-8.Novel and highly potent 5-HT3 receptor agonists based on a pyrroloquinoxaline structure. | ||||
| Ref 534584 | Different efficacy of specific agonists at 5-HT3 receptor splice variants: the role of the extra six amino acid segment. Br J Pharmacol. 1998 Feb;123(4):661-6. | ||||
| Ref 536188 | Emerging drugs for chemotherapy-induced emesis. Expert Opin Emerg Drugs. 2006 Mar;11(1):137-51. | ||||
| Ref 536224 | Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313. | ||||
| Ref 536543 | Local anesthetics have different mechanisms and sites of action at recombinant 5-HT3 receptors. Reg Anesth Pain Med. 2007 Nov-Dec;32(6):462-70. | ||||
| Ref 537011 | Palonosetron plus dexamethasone versus granisetron plus dexamethasone for prevention of nausea and vomiting during chemotherapy: a double-blind, double-dummy, randomised, comparative phase III trial.Lancet Oncol. 2009 Feb;10(2):115-24. Epub 2009 Jan 8. | ||||
| Ref 537217 | Role of serotonin in gastrointestinal motility and irritable bowel syndrome. Clin Chim Acta. 2009 May;403(1-2):47-55. Epub 2009 Feb 4. | ||||
| Ref 537311 | Management of postoperative nausea and vomiting: focus on palonosetron. Ther Clin Risk Manag. 2009 Feb;5(1):21-34. Epub 2009 Mar 26. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

