Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T77365
|
||||
Former ID |
TTDS00187
|
||||
Target Name |
Adenosine A2a receptor
|
||||
Gene Name |
ADORA2A
|
||||
Synonyms |
A(2A) adenosine receptor; A2a Adenosine receptor; Adenosine receptor A2a; ADORA2A
|
||||
Target Type |
Successful
|
||||
Disease | Arteriosclerosis [ICD9: 440; ICD10: I70] | ||||
Asthma; Chronic obstructive pulmonary disease [ICD9: 490-492, 493, 494-496; ICD10: J40-J44, J47, J45] | |||||
Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4] | |||||
Coronary disorder diagnosis [ICD9: 410-414, 429.2; ICD10: I20-I25] | |||||
Diabetic foot ulcer [ICD9: 707; ICD10: L88-L89] | |||||
Fatigue; Orthostatic hypotension [ICD9: 458.0, 780.7; ICD10: I95.1, R53] | |||||
Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
Hyperlipidaemia [ICD9: 272.0-272.4; ICD10: E78] | |||||
Multiple scierosis [ICD9: 340; ICD10: G35] | |||||
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Radionuclide imaging [ICD10: W88] | |||||
Schizophrenia [ICD9: 295; ICD10: F20] | |||||
Function |
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T77365
|
||||
UniProt ID | |||||
Sequence |
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS |
||||
Drugs and Mode of Action | |||||
Drug(s) | Caffeine | Drug Info | Approved | Fatigue; Orthostatic hypotension | [536949], [540664] |
Regadenoson | Drug Info | Approved | Radionuclide imaging | [529941], [540964] | |
Apadenoson | Drug Info | Phase 3 | Coronary disorder diagnosis | [522811], [540254] | |
Binodenoson | Drug Info | Phase 3 | Hypertension | [522738], [540963] | |
KW-6002 | Drug Info | Phase 3 | Parkinson's disease | [551079] | |
Tozadenant | Drug Info | Phase 3 | Parkinson's disease | [525212], [540980] | |
Tonapofylline | Drug Info | Phase 2/3 | Discovery agent | [522369], [540973] | |
AMP-579 | Drug Info | Phase 2 | Hyperlipidaemia | [544253] | |
BIIB014 | Drug Info | Phase 2 | Parkinson's disease | [536285], [540981] | |
Dexefaroxan | Drug Info | Phase 2 | Parkinson's disease | [526560] | |
MRE-0094 | Drug Info | Phase 2 | Diabetic foot ulcer | [536297] | |
SCH 420814 | Drug Info | Phase 2 | Parkinson's disease | [536285], [540983] | |
UK-432097 | Drug Info | Phase 2 | Asthma; Chronic obstructive pulmonary disease | [521962], [543123] | |
ATL-313 | Drug Info | Phase 1/2 | Arteriosclerosis | [523322], [540962] | |
OPA-6566 | Drug Info | Phase 1/2 | Glaucoma | [523581] | |
V81444 | Drug Info | Phase 1/2 | Parkinson's disease | [524937] | |
GW-328267 | Drug Info | Phase 1 | Allergic rhinitis | [523974] | |
KF-17837 | Drug Info | Phase 1 | Parkinson's disease | [546031] | |
SCH-442416 | Drug Info | Phase 1 | Discovery agent | [522117], [540246] | |
BVT-115959 | Drug Info | Discontinued in Phase 2 | Pain | [548203] | |
Dexefaroxan | Drug Info | Discontinued in Phase 2 | Schizophrenia | [536463] | |
Lu-AA47070 | Drug Info | Discontinued in Phase 1 | Parkinson's disease | [548653] | |
T-62 | Drug Info | Discontinued in Phase 1 | Neuropathic pain | [536374] | |
ARISTEROMYCIN | Drug Info | Terminated | Discovery agent | [546315] | |
CGS 21680 | Drug Info | Terminated | Discovery agent | [540510], [544564] | |
METHYLTHIOADENOSINE | Drug Info | Terminated | Multiple scierosis | [544778] | |
METRIFUDIL | Drug Info | Terminated | Discovery agent | [467595], [546171] | |
ZM-241385 | Drug Info | Terminated | Discovery agent | [540649], [546100] | |
Inhibitor | (1H-Imidazo[4,5-c]quinolin-4-yl)-phenyl-amine HCl | Drug Info | [530590] | ||
(2R,3S)-3-(6-Amino-purin-9-yl)-nonan-2-ol | Drug Info | [533722] | |||
(3-amino-5-bromobenzofuran-2-yl)(phenyl)methanone | Drug Info | [530650] | |||
(E,E)-8-(4-Phenylbutadien-1-yl)caffeine | Drug Info | [529653] | |||
(E,E)-8-[4-(3-Bromophenyl)butadien-1-yl]caffeine | Drug Info | [529653] | |||
(E,E)-8-[4-(3-Chlorophenyl)butadien-1-yl]caffeine | Drug Info | [529653] | |||
(E,E)-8-[4-(3-Fluorophenyl)butadien-1-yl]caffeine | Drug Info | [529653] | |||
(S)-DHPA | Drug Info | [530014] | |||
(Z)-8-(3-chlorostyryl)caffeine | Drug Info | [529653] | |||
1,3,7-Tripropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533486] | |||
1,3,8-Trimethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533394] | |||
1,3-Diallyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533429] | |||
1,3-Diallyl-7-methyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533486] | |||
1,3-Dibenzyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533486] | |||
1,3-Diethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533429] | |||
1,3-Diisobutyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533486] | |||
1,3-Dipropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533429] | |||
1,4-diaminoanthracene-9,10-dione | Drug Info | [530650] | |||
1-Allyl-3,7-dimethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533486] | |||
1-amino-2,4-bis(phenylthio)anthracene-9,10-dione | Drug Info | [530650] | |||
1-amino-2-phenoxyanthracene-9,10-dione | Drug Info | [530650] | |||
1-amino-4-chloroanthracene-9,10-dione | Drug Info | [530650] | |||
1-amino-4-methoxyanthracene-9,10-dione | Drug Info | [530650] | |||
1-aminoanthracene-9,10-dione | Drug Info | [530650] | |||
1-Butyl-8-phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [526958] | |||
1-Ethyl-3-methyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533486] | |||
1-Methyl-8-phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [526958] | |||
1-METHYLXANTHINE | Drug Info | [533429] | |||
1-Phenyl-3-(4-pyridin-2-yl-thiazol-2-yl)-urea | Drug Info | [526011] | |||
1H-Imidazo[4,5-c]quinolin-4-ylamine HCl | Drug Info | [530590] | |||
2,5'-dichloro-5'-deoxy-N6-cyclopentyladenosine | Drug Info | [530035] | |||
2,6,8-triphenyl-9H-purine | Drug Info | [528192] | |||
2,6-diphenyl-1-deazapurine | Drug Info | [528673] | |||
2,6-diphenyl-8-(1-ethylpropyl)-1-deazapurine | Drug Info | [528673] | |||
2,6-diphenyl-8-ethyl-1-deazapurine | Drug Info | [528673] | |||
2,6-diphenyl-8-methyl-1-deazapurine | Drug Info | [528673] | |||
2,6-diphenyl-8-tButyl-1-deazapurine | Drug Info | [528673] | |||
2,6-diphenyl-9H-purine | Drug Info | [528192] | |||
2,6-Diphenyl-pyrimidin-4-ylamine | Drug Info | [529299] | |||
2,6-dphenyl-8-propyl-1-deazapurine | Drug Info | [528673] | |||
2-(1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [529313] | |||
2-(2''-indolylethyloxy)adenosine | Drug Info | [528748] | |||
2-(2-furyl)-6-(1H-pyrazol-1-yl)pyrimidin-4-amine | Drug Info | [529255] | |||
2-(3''(5''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''(7''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''-(4''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''-(5''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''-(5''-fluoro-indolyl)ethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''-(5''-hydroxyindolyl)ethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''-(5''-iodo-indolyl)ethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''-(5''-methoxy-indolyl)ethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''-(6''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''-(6''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''-(benzoimidazole-1''-yl)ethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''-indolylethyloxy)adenosine | Drug Info | [528748] | |||
2-(3''-pyrrolylethyloxy)adenosine | Drug Info | [528748] | |||
2-(4-chlorophenyl)-6-phenyl-9H-purine | Drug Info | [528192] | |||
2-(4-ethylthiobenzimidazol-2-yl)quinoxaline | Drug Info | [527933] | |||
2-(4-hydroxypent-1-yl)-N6-methoxyadenosine | Drug Info | [528684] | |||
2-(4-methyl-1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [529313] | |||
2-(5-cyano-1-pent-1-ynyl)-N6-methoxyadenosine | Drug Info | [528684] | |||
2-(6-amino-8-bromo-9H-purin-9-yl)ethanol | Drug Info | [530966] | |||
2-(hex-1-ynyl)-N6-methoxyadenosine | Drug Info | [528684] | |||
2-amino-3-(m-tolylamino)naphthalene-1,4-dione | Drug Info | [530650] | |||
2-Amino-4,6-di-furan-2-yl-nicotinonitrile | Drug Info | [529602] | |||
2-Amino-4,6-di-thiophen-2-yl-nicotinonitrile | Drug Info | [529602] | |||
2-Amino-4,6-diphenyl-nicotinonitrile | Drug Info | [529602] | |||
2-Amino-4,6-diphenyl-pyrimidin-5-carbonitrile | Drug Info | [529299] | |||
2-Amino-4,6-diphenyl-pyrimidine | Drug Info | [529299] | |||
2-Amino-4-furan-2-yl-6-phenyl-nicotinonitrile | Drug Info | [529602] | |||
2-Amino-4-phenyl-6-thiophen-2-yl-nicotinonitrile | Drug Info | [529602] | |||
2-Amino-6-furan-2-yl-4-phenyl-nicotinonitrile | Drug Info | [529602] | |||
2-amino-6-phenyl-4-p-tolylnicotinonitrile | Drug Info | [528434] | |||
2-Amino-6-phenyl-4-thiophen-2-yl-nicotinonitrile | Drug Info | [529602] | |||
2-amino-N-benzyl-6-phenyl-9H-purine-9-carboxamide | Drug Info | [529421] | |||
2-chloro-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [529419] | |||
2-chloro-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [529419] | |||
2-chloro-N6-cyclopentyladenosine | Drug Info | [529098] | |||
2-Cyclopentyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [530590] | |||
2-ethyl-4-(furan-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [529419] | |||
2-ethyl-4-(furan-3-yl)thieno[3,2-d]pyrimidine | Drug Info | [529419] | |||
2-ethyl-4-(pyridin-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [529419] | |||
2-ethyl-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [529419] | |||
2-ethyl-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [529419] | |||
2-ethynyl-N6-methoxyadenosine | Drug Info | [528684] | |||
2-m-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [528969] | |||
2-p-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [528969] | |||
2-Phenyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [530590] | |||
2-phenyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [528969] | |||
2-phenylpropoxyadenosine | Drug Info | [528748] | |||
2-tolyl-6-phenyl-9H-purine | Drug Info | [528192] | |||
2-[(4-acetylphenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [528684] | |||
2-[(4-fluorophenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [528684] | |||
3-Benzyl-7-methyl-[1,8]naphthyridin-4-ol | Drug Info | [527683] | |||
3-Benzyl-7-methyl-[1,8]naphthyridine-4-thiol | Drug Info | [527683] | |||
3-Isobutyl-1-methyl-3,9-dihydro-purine-2,6-dione | Drug Info | [533486] | |||
3-Isopropyl-1-methyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533486] | |||
3-noradamantyl-1,3-dipropylxanthine | Drug Info | [528544] | |||
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
4-(ethylthio)-6-phenyl-1,3,5-triazin-2-amine | Drug Info | [528434] | |||
4-(furan-2-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine | Drug Info | [529858] | |||
4-(furan-2-yl)thieno[3,2-d]pyrimidin-2-amine | Drug Info | [529421] | |||
4-(thiazol-2-yl)thieno[3,2-d]pyrimidin-2-amine | Drug Info | [529419] | |||
4-Amino-2,6-diphenyl-pyrimidine-5-carbonitrile | Drug Info | [529299] | |||
4-amino-2-p-tolylisoindoline-1,3-dione | Drug Info | [530650] | |||
5,7-dibromo-9H-pyrido[3,4-b]indol-6-ol | Drug Info | [529305] | |||
5,7-diphenyl-3H-imidazo[4,5-b]pyridin-2-ol | Drug Info | [528673] | |||
5-Azido-6-benzyl-2-methyl-[1,8]naphthyridine | Drug Info | [527683] | |||
5-Butyl-8-phenyl-3H-[1,2,4]triazolo[5,1-i]purine | Drug Info | [527055] | |||
6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [529858] | |||
6-Furan-2-yl-9-phenethyl-9H-purin-2-ylamine | Drug Info | [527503] | |||
6-Furan-2-yl-9-phenyl-9H-purin-2-ylamine | Drug Info | [527503] | |||
6-guanidino-2-(3''-indolylethyloxy)adenosine | Drug Info | [528748] | |||
7-Allyl-1,3-dimethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533486] | |||
7-Allyl-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533486] | |||
7-Isopropyl-7H-adenine | Drug Info | [530014] | |||
7-Propyl-7H-adenine | Drug Info | [530014] | |||
8-Br-adenine | Drug Info | [530014] | |||
8-Bromo-9-(2,3-dihydroxypropyl)-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-(2-butyl)-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-(2-hydroxypropyl)-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-(3-hydroxypropyl)-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-(but-3-enyl)-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-(sec-butyl)-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-cyclobutyl-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-cyclohexyl-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-cyclopentyl-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-ethyl-9H-adenine | Drug Info | [530014] | |||
8-bromo-9-isobutyl-9H-purin-6-amine | Drug Info | [530966] | |||
8-Bromo-9-isopropyl-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-methyl-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-phenylethyl-9H-adenine | Drug Info | [530014] | |||
8-Bromo-9-propyl-9H-adenine | Drug Info | [530014] | |||
8-PHENYL THEOPHYLLINE | Drug Info | [530590] | |||
8-Phenyl-1-propyl-3,7-dihydro-purine-2,6-dione | Drug Info | [526958] | |||
8-propyl-2,6-diphenyl-9H-purine | Drug Info | [528192] | |||
9-(2-Hydroxyethyl)-9H-adenine | Drug Info | [530014] | |||
9-(2-Hydroxypropyl)-9H-adenine | Drug Info | [530014] | |||
9-(3-aminobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [529421] | |||
9-(3-Hydroxypropyl)-9H-adenine | Drug Info | [530014] | |||
9-(3-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [529421] | |||
9-(4-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [529421] | |||
9-(sec-Butyl)-9H-adenine | Drug Info | [530014] | |||
9-Allyl-8-bromo-9H-adenine | Drug Info | [530014] | |||
9-benzyl-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [529421] | |||
9-Benzyl-8-bromo-9H-adenine | Drug Info | [530014] | |||
9-BENZYL-9H-ADENINE | Drug Info | [530014] | |||
9-But-3-enyl-9H-adenine | Drug Info | [530014] | |||
9-Butyl-9H-adenine | Drug Info | [530014] | |||
9-Cyclobutyl-9H-adenine | Drug Info | [530014] | |||
9-Cycloheptyl-9H-adenine | Drug Info | [530014] | |||
9-Cyclopentyl-9H-adenine | Drug Info | [530014] | |||
9-Cyclopropyl-9H-adenine | Drug Info | [530014] | |||
9-Ethyl-8-phenylethynyl-9H-purin-6-ylamine | Drug Info | [526104] | |||
9-Ethyl-9H-adenine | Drug Info | [530014] | |||
9-Isopropyl-9H-adenine | Drug Info | [530014] | |||
9-Methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine | Drug Info | [527823] | |||
9-Methyl-9H-adenine | Drug Info | [530014] | |||
9-Phenylethyl-9H-adenine | Drug Info | [530014] | |||
9-Propyl-9H-adenine | Drug Info | [530014] | |||
ALLOXAZINE | Drug Info | [527823] | |||
ARISTEROMYCIN | Drug Info | [525783] | |||
Cyclohexyl-(2-phenoxy-9H-purin-6-yl)-amine | Drug Info | [527647] | |||
Cyclohexyl-(2-phenylsulfanyl-9H-purin-6-yl)-amine | Drug Info | [527647] | |||
Ethyl 5-benzoyl-4-phenylthiazol-2-ylcarbamate | Drug Info | [530752] | |||
FR-166124 | Drug Info | [525562] | |||
GALANGIN | Drug Info | [534439] | |||
GNF-PF-2224 | Drug Info | [530672] | |||
GNF-PF-2700 | Drug Info | [530966] | |||
ISOGUANOSINE | Drug Info | [551229] | |||
KF-17837 | Drug Info | [533955] | |||
Kuanoniamine D | Drug Info | [534583] | |||
LUF-5417 | Drug Info | [530752] | |||
LUF-5433 | Drug Info | [530752] | |||
LUF-5437 | Drug Info | [526011] | |||
LUF-5767 | Drug Info | [527331] | |||
LUF-5956 | Drug Info | [528192] | |||
LUF-5957 | Drug Info | [528192] | |||
LUF-5962 | Drug Info | [528192] | |||
LUF-5978 | Drug Info | [528673] | |||
LUF-5980 | Drug Info | [528673] | |||
LUF-5981 | Drug Info | [528673] | |||
Methyl 7-methoxy-4-phenylbenzofuran-2-ylcarbamate | Drug Info | [530599] | |||
METHYLTHIOADENOSINE | Drug Info | [527040] | |||
METRIFUDIL | Drug Info | [525578] | |||
N*6*-Cyclohexyl-N*2*-phenyl-9H-purine-2,6-diamine | Drug Info | [527647] | |||
N-(2,6-diphenylpyrimidin-4-yl)-2-ethylbutyramide | Drug Info | [527331] | |||
N-(2,6-diphenylpyrimidin-4-yl)-3-methylbutyramide | Drug Info | [527331] | |||
N-(2,6-diphenylpyrimidin-4-yl)acetamide | Drug Info | [527331] | |||
N-(2,6-diphenylpyrimidin-4-yl)butyramide | Drug Info | [527331] | |||
N-(2,6-diphenylpyrimidin-4-yl)isobutyramide | Drug Info | [527331] | |||
N-(2,6-diphenylpyrimidin-4-yl)propionamide | Drug Info | [527331] | |||
N-(2-(furan-2-yl)-3,4'-bipyridin-6-yl)acetamide | Drug Info | [530694] | |||
N-(3-Phenyl-[1,2,4]thiadiazol-5-yl)-benzamide | Drug Info | [526011] | |||
N-(4,6-diphenylpyrimidin-2-yl)propionamide | Drug Info | [527331] | |||
N-(4-Pyridin-2-yl-thiazol-2-yl)-benzamide | Drug Info | [526011] | |||
N-(5-Benzoyl-4-phenylthiazol-2-yl)benzamide | Drug Info | [530752] | |||
N-(7-methoxy-4-phenylbenzofuran-2-yl)acetamide | Drug Info | [530599] | |||
N6-((+/-)-endo-norborn-2-yl)adenosine | Drug Info | [530035] | |||
N6-(4-hydroxybenzyl)adenine riboside | Drug Info | [528752] | |||
N6-CYCLOPENTYLADENOSINE | Drug Info | [530752] | |||
N6-methoxy-2-phenylethynyladenosine | Drug Info | [528684] | |||
N6-methoxy-2-[(2-pyridinyl)ethynyl]adenosine | Drug Info | [528684] | |||
N6-methoxy-2-[(3-pyridinyl)ethynyl]-adenosine | Drug Info | [528684] | |||
N6-methoxy-2-[(4-methoxyphenyl)ethynyl]adenosine | Drug Info | [528684] | |||
N6-methoxy-2-[(4-pentylphenyl)ethynyl]adenosine | Drug Info | [528684] | |||
N6-methoxy-2-[(4-pyridinyl)ethynyl]adenosine | Drug Info | [528684] | |||
N6-methoxy-2-[2-(trimethylsilyl)ethynyl]adenosine | Drug Info | [528684] | |||
N6-[(4-Amino)-phenyl]-9-benzyl-2-phenyladenine | Drug Info | [529183] | |||
N6-[(4-Nitro)-phenyl]-9-benzyl-2-phenyladenine | Drug Info | [529183] | |||
NECA | Drug Info | [533449] | |||
OSIP-339391 | Drug Info | [530966] | |||
PD-115199 | Drug Info | [527717] | |||
Phenyl 7-methoxy-4-phenylbenzofuran-2-ylcarbamate | Drug Info | [530599] | |||
Phenyl(2-(trifluoromethyl)quinolin-4-yl)methanol | Drug Info | [529418] | |||
PSB-0788 | Drug Info | [530243] | |||
PSB-09120 | Drug Info | [530243] | |||
PSB-601 | Drug Info | [530243] | |||
R-N6-(phenylisopropyl)adenosine | Drug Info | [528748] | |||
SB-298 | Drug Info | [530243] | |||
SCH-442416 | Drug Info | [525917] | |||
SCH-63390 | Drug Info | [534646] | |||
ST-1535 | Drug Info | [529602] | |||
Tonapofylline | Drug Info | [530752] | |||
ZM-241385 | Drug Info | [530372] | |||
Modulator | AMP-579 | Drug Info | [527148] | ||
GW-328267 | Drug Info | ||||
KW-6002 | Drug Info | ||||
MSX-3 | Drug Info | [540978] | |||
Regadenoson | Drug Info | [551871] | |||
Agonist | Apadenoson | Drug Info | [540254] | ||
ATL-313 | Drug Info | [528143] | |||
Binodenoson | Drug Info | [528865] | |||
BVT-115959 | Drug Info | [531316] | |||
CGS 21680 | Drug Info | [535415] | |||
Dexefaroxan | Drug Info | [536463] | |||
MRE-0094 | Drug Info | [536297] | |||
OPA-6566 | Drug Info | [550203] | |||
UK-432097 | Drug Info | [531387] | |||
Antagonist | BIIB014 | Drug Info | [536285] | ||
Caffeine | Drug Info | [535951], [536302] | |||
Lu-AA47070 | Drug Info | [531680] | |||
SCH 420814 | Drug Info | [536285] | |||
SCH58261 | Drug Info | [535245], [535757] | |||
T-62 | Drug Info | [536374] | |||
Tozadenant | Drug Info | [532878] | |||
V81444 | Drug Info | [532726] | |||
Pathways | |||||
KEGG Pathway | Rap1 signaling pathway | ||||
Calcium signaling pathway | |||||
cAMP signaling pathway | |||||
Neuroactive ligand-receptor interaction | |||||
Vascular smooth muscle contraction | |||||
Parkinson' | |||||
s disease | |||||
Alcoholism | |||||
Pathway Interaction Database | HIF-2-alpha transcription factor network | ||||
PathWhiz Pathway | Intracellular Signalling Through Adenosine Receptor A2a and Adenosine | ||||
Reactome | NGF-independant TRKA activation | ||||
Adenosine P1 receptors | |||||
G alpha (s) signalling events | |||||
Surfactant metabolism | |||||
WikiPathways | Nucleotide GPCRs | ||||
Monoamine Transport | |||||
GPCRs, Class A Rhodopsin-like | |||||
NGF signalling via TRKA from the plasma membrane | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
GPCRs, Other | |||||
References | |||||
Ref 467595 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 426). | ||||
Ref 521962 | ClinicalTrials.gov (NCT00430300) Safety And Efficacy Of UK-432,097 In Chronic Obstructive Pulmonary Disease.. U.S. National Institutes of Health. | ||||
Ref 522117 | ClinicalTrials.gov (NCT00531193) Using PET Scans to Study Brain Receptor Occupancy of BIIB014 in Healthy Male Volunteers. U.S. National Institutes of Health. | ||||
Ref 522369 | ClinicalTrials.gov (NCT00709865) Phase 2b Study to Assess the Safety and Tolerability of IV Tonapofylline in Subjects With Acute Decompensated Heart Failure (ADHF) and Renal Insufficiency. U.S. National Institutes of Health. | ||||
Ref 522738 | ClinicalTrials.gov (NCT00944970) Efficacy and Safety Study of Binodenoson in Assessing Cardiac Ischemia. U.S. National Institutes of Health. | ||||
Ref 522811 | ClinicalTrials.gov (NCT00990327) Study of the Safety and Efficacy of Apadenoson for Detection of Myocardial Perfusion Defects Using SPECT MPI. U.S. National Institutes of Health. | ||||
Ref 523322 | ClinicalTrials.gov (NCT01279083) Safety and Efficacy Trial to Treat Open-Angle Glaucoma or Ocular Hypertension. U.S. National Institutes of Health. | ||||
Ref 523581 | ClinicalTrials.gov (NCT01410188) Safety/Efficacy Study: OPA-6566 Ophthalmic Solution in Subjects With Primary Open-Angle Glaucoma or Ocular Hypertension. U.S. National Institutes of Health. | ||||
Ref 523974 | ClinicalTrials.gov (NCT01640990) A Study to Assess the Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of an Intravenous Infusion of GW328267X in Healthy Volunteers. U.S. National Institutes of Health. | ||||
Ref 524937 | ClinicalTrials.gov (NCT02253745) Safety, Tolerability, PK & Efficacy of V81444 in Volunteers With Attention Deficit/ Hyperactivity Disorder (ADHD). U.S. National Institutes of Health. | ||||
Ref 525212 | ClinicalTrials.gov (NCT02453386) Safety and Efficacy Study of Tozadenant to Treat End of Dose Wearing Off in Parkinson's Patients Using Levodopa. | ||||
Ref 526560 | Effects of the alpha 2-adrenoreceptor antagonist dexefaroxan on neurogenesis in the olfactory bulb of the adult rat in vivo: selective protection against neuronal death. Neuroscience. 2003;117(2):281-91. | ||||
Ref 536285 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | ||||
Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
Ref 540246 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3283). | ||||
Ref 540254 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3290). | ||||
Ref 540510 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 375). | ||||
Ref 540649 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 405). | ||||
Ref 540664 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 407). | ||||
Ref 540962 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5594). | ||||
Ref 540963 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5595). | ||||
Ref 540964 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5596). | ||||
Ref 540973 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5605). | ||||
Ref 540980 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5611). | ||||
Ref 540981 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5612). | ||||
Ref 540983 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5614). | ||||
Ref 543123 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8420). | ||||
Ref 544253 | Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May; 1808(5): 1290-1308. | ||||
Ref 544564 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000147) | ||||
Ref 544778 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000987) | ||||
Ref 546031 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005980) | ||||
Ref 546100 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006356) | ||||
Ref 546171 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006749) | ||||
Ref 546315 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007402) | ||||
Ref 548203 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023039) | ||||
Ref 525562 | Bioorg Med Chem Lett. 1999 Jul 19;9(14):1979-84.Discovery of FR166124, a novel water-soluble pyrazolo-[1,5-a]pyridine adenosine A1 receptor antagonist. | ||||
Ref 525578 | J Med Chem. 1999 Sep 9;42(18):3463-77.N-substituted adenosines as novel neuroprotective A(1) agonists with diminished hypotensive effects. | ||||
Ref 525783 | J Med Chem. 2000 Jun 1;43(11):2196-203.Methanocarba analogues of purine nucleosides as potent and selective adenosine receptor agonists. | ||||
Ref 525917 | J Med Chem. 2000 Nov 16;43(23):4359-62.Design, radiosynthesis, and biodistribution of a new potent and selective ligand for in vivo imaging of the adenosine A(2A) receptor system using positron emission tomography. | ||||
Ref 526011 | J Med Chem. 2001 Mar 1;44(5):749-62.Thiazole and thiadiazole analogues as a novel class of adenosine receptor antagonists. | ||||
Ref 526104 | Bioorg Med Chem Lett. 2001 Jul 23;11(14):1931-4.Introduction of alkynyl chains on C-8 of adenosine led to very selective antagonists of the A(3) adenosine receptor. | ||||
Ref 526958 | J Med Chem. 2004 Feb 12;47(4):1031-43.Preparation, properties, reactions, and adenosine receptor affinities of sulfophenylxanthine nitrophenyl esters: toward the development of sulfonic acid prodrugswith peroral bioavailability. | ||||
Ref 527040 | J Med Chem. 2004 Apr 22;47(9):2243-55.Novel amino acid derived natural products from the ascidian Atriolum robustum: identification and pharmacological characterization of a unique adenosine derivative. | ||||
Ref 527055 | Bioorg Med Chem Lett. 2004 May 17;14(10):2443-6.Facile synthesis of fused 1,2,4-triazolo[1,5-c]pyrimidine derivatives as human adenosine A3 receptor ligands. | ||||
Ref 527148 | Adenosine A1/A2a receptor agonist AMP-579 induces acute and delayed preconditioning against in vivo myocardial stunning. Am J Physiol Heart Circ Physiol. 2004 Dec;287(6):H2746-53. Epub 2004 Jul 22. | ||||
Ref 527331 | J Med Chem. 2004 Dec 16;47(26):6529-40.2,4,6-trisubstituted pyrimidines as a new class of selective adenosine A1 receptor antagonists. | ||||
Ref 527503 | Bioorg Med Chem Lett. 2005 Apr 15;15(8):2119-22.6-(2-Furanyl)-9H-purin-2-amine derivatives as A2A adenosine antagonists. | ||||
Ref 527647 | J Med Chem. 2005 Jul 28;48(15):4910-8."Reversine" and its 2-substituted adenine derivatives as potent and selective A3 adenosine receptor antagonists. | ||||
Ref 527683 | Bioorg Med Chem Lett. 2005 Oct 15;15(20):4604-10.1,8-Naphthyridin-4-one derivatives as new ligands of A2A adenosine receptors. | ||||
Ref 527717 | J Med Chem. 1992 Jun 12;35(12):2342-5.(E)-1,3-dialkyl-7-methyl-8-(3,4,5-trimethoxystyryl)xanthines: potent and selective adenosine A2 antagonists. | ||||
Ref 527823 | J Med Chem. 2005 Nov 3;48(22):6887-96.2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacological characterization. | ||||
Ref 527933 | J Med Chem. 2005 Dec 29;48(26):8253-60.2-(Benzimidazol-2-yl)quinoxalines: a novel class of selective antagonists at human A(1) and A(3) adenosine receptors designed by 3D database searching. | ||||
Ref 528143 | Effect of novel A2A adenosine receptor agonist ATL 313 on Clostridium difficile toxin A-induced murine ileal enteritis. Infect Immun. 2006 May;74(5):2606-12. | ||||
Ref 528192 | J Med Chem. 2006 May 18;49(10):2861-7.2,6-disubstituted and 2,6,8-trisubstituted purines as adenosine receptor antagonists. | ||||
Ref 528434 | Bioorg Med Chem Lett. 2006 Dec 1;16(23):5993-7. Epub 2006 Sep 12.Identification of non-furan containing A2A antagonists using database mining and molecular similarity approaches. | ||||
Ref 528544 | J Med Chem. 2006 Nov 30;49(24):7119-31.Potent and orally bioavailable 8-bicyclo[2.2.2]octylxanthines as adenosine A1 receptor antagonists. | ||||
Ref 528673 | J Med Chem. 2007 Feb 22;50(4):828-34.2,6,8-trisubstituted 1-deazapurines as adenosine receptor antagonists. | ||||
Ref 528684 | J Med Chem. 2007 Mar 22;50(6):1222-30. Epub 2007 Feb 20.N6-methoxy-2-alkynyladenosine derivatives as highly potent and selective ligands at the human A3 adenosine receptor. | ||||
Ref 528748 | J Med Chem. 2007 Apr 19;50(8):1810-27. Epub 2007 Mar 23.Structure-activity relationships of 2,N(6),5'-substituted adenosine derivatives with potent activity at the A2B adenosine receptor. | ||||
Ref 528752 | J Nat Prod. 2007 Apr;70(4):571-4. Epub 2007 Mar 24.Neuroprotective principles from Gastrodia elata. | ||||
Ref 528865 | Coronary circulation responses to binodenoson, a selective adenosine A2A receptor agonist. Am J Cardiol. 2007 Jun 1;99(11):1507-12. Epub 2007 Apr 16. | ||||
Ref 528969 | J Med Chem. 2007 Aug 23;50(17):4061-74. Epub 2007 Aug 1.New 2-arylpyrazolo[3,4-c]quinoline derivatives as potent and selective human A3 adenosine receptor antagonists. Synthesis, pharmacological evaluation, and ligand-receptor modeling studies. | ||||
Ref 529098 | Bioorg Med Chem. 2008 Jan 1;16(1):336-53. Epub 2007 Sep 22.5'-Carbamoyl derivatives of 2'-C-methyl-purine nucleosides as selective A1 adenosine receptor agonists: affinity, efficacy, and selectivityfor A1 receptor from different species. | ||||
Ref 529183 | Eur J Med Chem. 2008 Aug;43(8):1639-47. Epub 2007 Oct 24.N6-1,3-diphenylurea derivatives of 2-phenyl-9-benzyladenines and 8-azaadenines: synthesis and biological evaluation as allosteric modulators of A2A adenosine receptors. | ||||
Ref 529255 | J Med Chem. 2008 Feb 14;51(3):400-6. Epub 2008 Jan 12.Identification of novel, water-soluble, 2-amino-N-pyrimidin-4-yl acetamides as A2A receptor antagonists with in vivo efficacy. | ||||
Ref 529299 | Bioorg Med Chem. 2008 Mar 15;16(6):2741-52. Epub 2008 Jan 12.A new generation of adenosine receptor antagonists: from di- to trisubstituted aminopyrimidines. | ||||
Ref 529305 | Bioorg Med Chem. 2008 Apr 1;16(7):3825-30. Epub 2008 Jan 30.Synthesis of eudistomin D analogues and its effects on adenosine receptors. | ||||
Ref 529313 | J Med Chem. 2008 Mar 27;51(6):1764-70. Epub 2008 Feb 13.Derivatives of 4-amino-6-hydroxy-2-mercaptopyrimidine as novel, potent, and selective A3 adenosine receptor antagonists. | ||||
Ref 529418 | Bioorg Med Chem Lett. 2008 May 1;18(9):2916-9. Epub 2008 Mar 30.Antagonists of the human adenosine A2A receptor. Part 1: Discovery and synthesis of thieno[3,2-d]pyrimidine-4-methanone derivatives. | ||||
Ref 529419 | Bioorg Med Chem Lett. 2008 May 1;18(9):2920-3. Epub 2008 Mar 30.Antagonists of the human adenosine A2A receptor. Part 2: Design and synthesis of 4-arylthieno[3,2-d]pyrimidine derivatives. | ||||
Ref 529421 | Bioorg Med Chem Lett. 2008 May 1;18(9):2924-9. Epub 2008 Mar 30.Antagonists of the human adenosine A2A receptor. Part 3: Design and synthesis of pyrazolo[3,4-d]pyrimidines, pyrrolo[2,3-d]pyrimidinesand 6-arylpurines. | ||||
Ref 529602 | J Med Chem. 2008 Aug 14;51(15):4449-55. Epub 2008 Jul 19.2-Amino-6-furan-2-yl-4-substituted nicotinonitriles as A2A adenosine receptor antagonists. | ||||
Ref 529653 | Bioorg Med Chem. 2008 Sep 15;16(18):8676-84. Epub 2008 Aug 5.Dual inhibition of monoamine oxidase B and antagonism of the adenosine A(2A) receptor by (E,E)-8-(4-phenylbutadien-1-yl)caffeine analogues. | ||||
Ref 529858 | J Med Chem. 2009 Jan 8;52(1):33-47.Antagonists of the human A(2A) adenosine receptor. 4. Design, synthesis, and preclinical evaluation of 7-aryltriazolo[4,5-d]pyrimidines. | ||||
Ref 530014 | Bioorg Med Chem. 2009 Apr 1;17(7):2812-22. Epub 2009 Feb 23.8-Bromo-9-alkyl adenine derivatives as tools for developing new adenosine A2A and A2B receptors ligands. | ||||
Ref 530035 | J Med Chem. 2009 Apr 23;52(8):2393-406.N6-Cycloalkyl- and N6-bicycloalkyl-C5'(C2')-modified adenosine derivatives as high-affinity and selective agonists at the human A1 adenosine receptor with antinociceptive effects in mice. | ||||
Ref 530243 | J Med Chem. 2009 Jul 9;52(13):3994-4006.1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with subnanomolar affinity and subtype specificity. | ||||
Ref 530372 | J Med Chem. 2009 Dec 10;52(23):7640-52.2-Phenylpyrazolo[4,3-d]pyrimidin-7-one as a new scaffold to obtain potent and selective human A3 adenosine receptor antagonists: new insights into the receptor-antagonist recognition. | ||||
Ref 530590 | J Med Chem. 1991 Mar;34(3):1202-6.1H-imidazo[4,5-c]quinolin-4-amines: novel non-xanthine adenosine antagonists. | ||||
Ref 530599 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):1090-3. Epub 2009 Dec 11.Synthetic studies on selective adenosine A2A receptor antagonists: synthesis and structure-activity relationships of novel benzofuran derivatives. | ||||
Ref 530650 | J Med Chem. 2010 Feb 25;53(4):1799-809.Structure-based discovery of novel chemotypes for adenosine A(2A) receptor antagonists. | ||||
Ref 530672 | Eur J Med Chem. 2010 May;45(5):1739-45. Epub 2010 Jan 14.Synthesis and theoretical studies on energetics of novel N- and O- perfluoroalkyl triazole tagged thienopyrimidines--their potential as adenosine receptor ligands. | ||||
Ref 530694 | Bioorg Med Chem Lett. 2010 Mar 1;20(5):1697-700. Epub 2010 Jan 20.Discovery of N-(5,6-diarylpyridin-2-yl)amide derivatives as potent and selective A(2B) adenosine receptor antagonists. | ||||
Ref 530752 | Bioorg Med Chem. 2010 Mar 15;18(6):2195-203. Epub 2010 Feb 4.2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists. | ||||
Ref 530966 | Eur J Med Chem. 2010 Aug;45(8):3459-71. Epub 2010 May 7.Insights into binding modes of adenosine A(2B) antagonists with ligand-based and receptor-based methods. | ||||
Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
Ref 531316 | Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May;1808(5):1290-308. | ||||
Ref 531387 | Structure of an agonist-bound human A2A adenosine receptor. Science. 2011 Apr 15;332(6027):322-7. | ||||
Ref 531680 | The novel adenosine A2A antagonist Lu AA47070 reverses the motor and motivational effects produced by dopamine D2 receptor blockade. Pharmacol Biochem Behav. 2012 Jan;100(3):498-505. | ||||
Ref 532726 | Adenosine A2A receptor antagonists in Parkinson's disease: progress in clinical trials from the newly approved istradefylline to drugs in early development and those already discontinued. CNS Drugs. 2014 May;28(5):455-74. | ||||
Ref 532878 | Tozadenant (SYN115) in patients with Parkinson's disease who have motor fluctuations on levodopa: a phase 2b, double-blind, randomised trial. Lancet Neurol. 2014 Aug;13(8):767-76. | ||||
Ref 533394 | J Med Chem. 1985 Apr;28(4):487-92.1,3-Dialkyl-8-(p-sulfophenyl)xanthines: potent water-soluble antagonists for A1- and A2-adenosine receptors. | ||||
Ref 533429 | J Med Chem. 1988 Oct;31(10):2034-9.Benzo[1,2-c:5,4-c']dipyrazoles: non-xanthine adenosine antagonists. | ||||
Ref 533449 | J Med Chem. 1988 Jun;31(6):1179-83.Adenosine receptor agonists: synthesis and biological evaluation of 1-deaza analogues of adenosine derivatives. | ||||
Ref 533486 | J Med Chem. 1986 Jul;29(7):1305-8.Analogues of caffeine and theophylline: effect of structural alterations on affinity at adenosine receptors. | ||||
Ref 533722 | J Med Chem. 1995 May 12;38(10):1720-35.Structure-activity relationships of 9-alkyladenine and ribose-modified adenosine derivatives at rat A3 adenosine receptors. | ||||
Ref 533955 | J Med Chem. 1993 Nov 12;36(23):3731-3.Photoisomerization of a potent and selective adenosine A2 antagonist, (E)-1,3-Dipropyl-8-(3,4-dimethoxystyryl)-7-methylxanthine. | ||||
Ref 534439 | J Med Chem. 1997 Aug 1;40(16):2588-95.Mutagenesis reveals structure-activity parallels between human A2A adenosine receptors and biogenic amine G protein-coupled receptors. | ||||
Ref 534583 | J Nat Prod. 1998 Feb;61(2):301-5.Bioactive pyridoacridine alkaloids from the micronesian sponge Oceanapia sp. | ||||
Ref 534646 | J Med Chem. 1998 Jun 4;41(12):2126-33.Design, synthesis, and biological evaluation of a second generation of pyrazolo[4,3-e]-1,2,4-triazolo[1,5-c]pyrimidines as potent and selective A2A adenosine receptor antagonists. | ||||
Ref 535245 | Adenosine A2A receptor antagonists are potential antidepressants: evidence based on pharmacology and A2A receptor knockout mice. Br J Pharmacol. 2001 Sep;134(1):68-77. | ||||
Ref 535415 | Effects of CGS 21680, a selective adenosine A2A receptor agonist, on allergic airways inflammation in the rat. Eur J Pharmacol. 2002 Mar 8;438(3):183-8. | ||||
Ref 535757 | Blockade of A2A adenosine receptors prevents basic fibroblast growth factor-induced reactive astrogliosis in rat striatal primary astrocytes. Glia. 2003 Aug;43(2):190-4. | ||||
Ref 535951 | Caffeine as a psychomotor stimulant: mechanism of action. Cell Mol Life Sci. 2004 Apr;61(7-8):857-72. | ||||
Ref 536285 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | ||||
Ref 536302 | Adenosine receptor antagonists intensify the benzodiazepine withdrawal signs in mice. Pharmacol Rep. 2006 Sep-Oct;58(5):643-51. | ||||
Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
Ref 540254 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3290). | ||||
Ref 540978 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5610). |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.