Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T53748
|
||||
Former ID |
TTDS00235
|
||||
Target Name |
Enoyl-ACP reductase
|
||||
Gene Name |
fabI
|
||||
Synonyms |
Enoyl-ACP reductase FabI; Enoyl-acyl carrier protein reductase; Enoyl-acyl carrier reductase; Enoyl-acyl-carrier protein reductase; FABI; NADH-dependent enoyl-ACP reductase; fabI
|
||||
Target Type |
Successful
|
||||
Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
Infection of P. falciparum; Trypanosoma [ICD9: 084, 086; ICD10: B50-B54, B56] | |||||
Malaria [ICD10: B54] | |||||
Function |
Catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). Involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis (By similarity).
|
||||
BioChemical Class |
Oxidoreductases acting on CH-CH group of donors
|
||||
Target Validation |
T53748
|
||||
UniProt ID | |||||
EC Number |
EC 1.3.1.9
|
||||
Sequence |
MNKISQRLLFLFLHFYTTVCFIQNNTQKTFHNVLQNEQIRGKEKAFYRKEKRENIFIGNK
MKHVHNMNNTHNNNHYMEKEEQDASNINKIKEENKNEDICFIAGIGDTNGYGWGIAKELS KRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMIIDKDKKMNILDMLPFDASFDTANDIDEE TKNNKRYNMLQNYPIEDVANLIHQKYGKINMLVHSLANAKEVQKDLLNTSRKGYLDALSK SSYSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLG RNYNIRINTISAGPLKSRAATAINKLNNTYENNTNQNKNRNSHDVHNIMNNSGEKEEKKN SASQNYTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIM FLPDDIYRNENE |
||||
Drugs and Mode of Action | |||||
Inhibitor | (-)-CATECHINGALLATE | Drug Info | [528213] | ||
2-(2,4-dichlorophenoxy)-5-(2-methylbutyl)phenol | Drug Info | [529962] | |||
2-(2,4-dichlorophenoxy)-5-(3-phenylpropyl)phenol | Drug Info | [528892] | |||
2-(2,4-dichlorophenoxy)-5-ethylphenol | Drug Info | [528892] | |||
2-(2,4-dichlorophenoxy)-5-isobutylphenol | Drug Info | [529962] | |||
2-(2,4-dichlorophenoxy)-5-isopentylphenol | Drug Info | [529962] | |||
2-(2,4-dichlorophenoxy)-5-methylphenol | Drug Info | [528892] | |||
2-(2,4-dichlorophenoxy)-5-phenethylphenol | Drug Info | [529962] | |||
2-(2,4-dichlorophenoxy)-5-propylphenol | Drug Info | [528892] | |||
2-(2-((benzylamino)methyl)phenoxy)-5-chlorophenol | Drug Info | [528023] | |||
2-(4-amino-2-chlorophenoxy)-5-chlorophenol | Drug Info | [527778] | |||
2-(4-chloro-2-hydroxyphenoxy)benzenaminium | Drug Info | [529962] | |||
3,7-dihydroxy-flavone | Drug Info | [528213] | |||
3-chloro-4-(4-chloro-2-hydroxyphenoxy)benzamide | Drug Info | [527778] | |||
4-(2,4-dichloro-phenoxy)-2'-methyl-biphenyl-3-ol | Drug Info | [528892] | |||
4-(2,4-dichloro-phenoxy)-4'-fluoro-biphenyl-3-ol | Drug Info | [528892] | |||
4-(2,4-dichloro-phenoxy)-biphenyl-3-ol | Drug Info | [528892] | |||
4-(2,4-dichlorophenoxy)-3'-methylbiphenyl-3-ol | Drug Info | [529962] | |||
4-(2,4-dichlorophenoxy)-3-hydroxybenzonitrile | Drug Info | [528892] | |||
4-(2,4-dichlorophenoxy)-4'-methylbiphenyl-3-ol | Drug Info | [529962] | |||
4-(2-Thienyl)-1-(4-Methylbenzyl)-1h-Imidazole | Drug Info | [551393] | |||
5-benzyl-2-(2,4-dichlorophenoxy)phenol | Drug Info | [529962] | |||
5-butyl-2-(2,4-dichlorophenoxy)phenol | Drug Info | [529962] | |||
5-chloro-2-(2-chloro-4-hydroxyphenoxy)phenol | Drug Info | [527778] | |||
5-chloro-2-(2-chloro-4-nitrophenoxy)phenol | Drug Info | [527778] | |||
Beta-D-Glucose | Drug Info | [551393] | |||
BUTEIN | Drug Info | [528645] | |||
Diazaborines | Drug Info | [535276] | |||
EPIGALOCATECHIN GALLATE | Drug Info | [528645] | |||
FISETIN | Drug Info | [528213] | |||
GALLOCATECHIN GALLATE | Drug Info | [528213] | |||
Indole Naphthyridinone | Drug Info | [551393] | |||
ISORHAMNETIN | Drug Info | [528213] | |||
MORIN | Drug Info | [528213] | |||
Nicotinamide-Adenine-Dinucleotide | Drug Info | [551393] | |||
OROIDIN | Drug Info | [529012] | |||
Thiolactomycin | Drug Info | [536636] | |||
Binder | Triclosan | Drug Info | [535276], [535329], [536636] | ||
WL-1001 | Drug Info | [536135] | |||
References | |||||
Ref 527778 | Bioorg Med Chem Lett. 2005 Dec 1;15(23):5247-52. Epub 2005 Sep 29.Synthesis, biological activity, and X-ray crystal structural analysis of diaryl ether inhibitors of malarial enoyl acyl carrier protein reductase. Part 1: 4'-substituted triclosan derivatives. | ||||
Ref 528023 | Bioorg Med Chem Lett. 2006 Apr 15;16(8):2163-9. Epub 2006 Feb 8.Synthesis and biological activity of diaryl ether inhibitors of malarial enoyl acyl carrier protein reductase. Part 2: 2'-substituted triclosan derivatives. | ||||
Ref 528213 | J Med Chem. 2006 Jun 1;49(11):3345-53.Inhibition of Plasmodium falciparum fatty acid biosynthesis: evaluation of FabG, FabZ, and FabI as drug targets for flavonoids. | ||||
Ref 528645 | J Med Chem. 2007 Feb 22;50(4):765-75. Epub 2007 Jan 31.Green tea catechins potentiate triclosan binding to enoyl-ACP reductase from Plasmodium falciparum (PfENR). | ||||
Ref 528892 | J Biol Chem. 2007 Aug 31;282(35):25436-44. Epub 2007 Jun 13.X-ray structural analysis of Plasmodium falciparum enoyl acyl carrier protein reductase as a pathway toward the optimization of triclosan antimalarial efficacy. | ||||
Ref 529012 | Bioorg Med Chem. 2007 Nov 1;15(21):6834-45. Epub 2007 Aug 22.Marine natural products from the Turkish sponge Agelas oroides that inhibit the enoyl reductases from Plasmodium falciparum, Mycobacterium tuberculosis and Escherichia coli. | ||||
Ref 529962 | Eur J Med Chem. 2009 Jul;44(7):3009-19. Epub 2009 Jan 19.Design and in silico screening of combinatorial library of antimalarial analogs of triclosan inhibiting Plasmodium falciparum enoyl-acyl carrier protein reductase. | ||||
Ref 535276 | Lipid biosynthesis as a target for antibacterial agents. Prog Lipid Res. 2001 Nov;40(6):467-97. | ||||
Ref 536135 | Opportunities and challenges in antiparasitic drug discovery. Nat Rev Drug Discov. 2005 Sep;4(9):727-40. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.