Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T11754
|
||||
Former ID |
TTDS00177
|
||||
Target Name |
Fatty-acid amide hydrolase
|
||||
Gene Name |
FAAH
|
||||
Synonyms |
Anandamide amidase; Anandamide amidohydrolase; Anandamide synthase; Arachidonylethanolamide synthase; Fatty acid amide hydrolase; Oleamidehydrolase; FAAH
|
||||
Target Type |
Successful
|
||||
Disease | Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | ||||
Anesthesia [ICD9: 338; ICD10: R20.0] | |||||
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
Liver disease [ICD9: 570-574; ICD10: K70-K77] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Unspecified [ICD code not available] | |||||
Function |
Degradesbioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates.
|
||||
BioChemical Class |
Carbon-nitrogen hydrolase
|
||||
Target Validation |
T11754
|
||||
UniProt ID | |||||
EC Number |
EC 3.5.1.99
|
||||
Sequence |
MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS |
||||
Drugs and Mode of Action | |||||
Drug(s) | Propofol | Drug Info | Approved | Anesthesia | [525679], [540866] |
Thiopental | Drug Info | Approved | Anesthesia | [538450], [539663] | |
IW-6118 | Drug Info | Phase 2 | Inflammatory disease | [523013] | |
PF-04457845 | Drug Info | Phase 2 | Liver disease | [541799] | |
SSR411298 | Drug Info | Phase 2 | Major depressive disorder | [522544] | |
IPI-940 | Drug Info | Phase 1 | Pain | [548828] | |
Propofol | Drug Info | Investigative | Unspecified | [535758], [536166] | |
Inhibitor | (+/-)-3-(but-3-enyl)-1-pent-4-enoylazetidin-2-one | Drug Info | [529529] | ||
(+/-)-3-(pent-4-enyl)azetidin-2-one | Drug Info | [529529] | |||
(+/-)-3-allyl-1-pent-4-enoylazetidin-2-one | Drug Info | [529529] | |||
(+/-)-3-allylazetidin-2-one | Drug Info | [529529] | |||
(+/-)-oxiran-2-ylmethyl (9Z)-hexadec-9-enoate | Drug Info | [529008] | |||
(+/-)-oxiran-2-ylmethyl (9Z)-octadec-9-enoate | Drug Info | [529008] | |||
(Z)-1,1,1-Trifluoro-nonadec-10-en-2-one | Drug Info | [527476] | |||
(Z)-1-(4-phenyloxazol-2-yl)octadec-9-en-1-one | Drug Info | [529193] | |||
(Z)-1-(benzo[d]oxazol-2-yl)octadec-9-en-1-one | Drug Info | [529193] | |||
(Z)-1-(pyridazin-3-yl)octadec-9-en-1-one | Drug Info | [529193] | |||
(Z)-2,2-Dimethyl-1-oxazol-2-yl-octadec-9-en-1-one | Drug Info | [526085] | |||
(Z)-2-Methyl-1-oxazol-2-yl-octadec-9-en-1-one | Drug Info | [526085] | |||
1,1,1-trifluoro-3-(hexylthio)propan-2-one | Drug Info | [529157] | |||
1,1,1-trifluoro-3-(octylsulfinyl)propan-2-one | Drug Info | [529157] | |||
1,1,1-trifluoro-3-(octylsulfonyl)propan-2-one | Drug Info | [529157] | |||
1,1,1-trifluoro-3-(octylthio)propan-2-one | Drug Info | [529157] | |||
1,1,1-Trifluoro-7-phenylheptan-2-one | Drug Info | [527476] | |||
1,1,1-Trifluoro-8-phenyl-octan-2-one | Drug Info | [527476] | |||
1,1,1-Trifluoro-9-phenyl-nonan-2-one | Drug Info | [527476] | |||
1,1,1-Trifluoro-nonadecan-2-one | Drug Info | [527476] | |||
1,1,1-Trifluoro-tridecan-2-one | Drug Info | [527476] | |||
1,1,1-Trifluoro-undecan-2-one | Drug Info | [527476] | |||
1,1,1-trifluorododecan-2-one | Drug Info | [529157] | |||
1,10-(methylenedi-4,1-phenylene)bismaleimide | Drug Info | [530251] | |||
1,4-bis(malimido)xylene | Drug Info | [530251] | |||
1,8-bis-maleimidodiethyleneglycol | Drug Info | [530251] | |||
1-(1,2,4-Oxadiazol-3-yl)-7-phenylheptan-1-one | Drug Info | [529594] | |||
1-(1,2,4-Oxadiazol-5-yl)-7-phenylheptan-1-one | Drug Info | [529594] | |||
1-(1,3,4-Oxadiazol-2-yl)-7-phenylheptan-1-one | Drug Info | [529594] | |||
1-(1,3,4-oxadiazol-2-yl)octadec-9-en-1-one | Drug Info | [529594] | |||
1-(1,3,4-thiadiazol-2-yl)octadec-9-en-1-one | Drug Info | [529594] | |||
1-(4-acetyloxazol-2-yl)-7-phenylheptan-1-one | Drug Info | [529603] | |||
1-(4-bromooxazol-2-yl)-7-phenylheptan-1-one | Drug Info | [529603] | |||
1-(4-chlorooxazol-2-yl)-7-phenylheptan-1-one | Drug Info | [529603] | |||
1-(4-iodooxazol-2-yl)-7-phenylheptan-1-one | Drug Info | [529603] | |||
1-(4-methoxyoxazol-2-yl)-7-phenylheptan-1-one | Drug Info | [529603] | |||
1-(4-methyloxazol-2-yl)-7-phenylheptan-1-one | Drug Info | [529603] | |||
1-(5-(furan-2-yl)oxazol-2-yl)octadec-9-en-1-one | Drug Info | [529594] | |||
1-(5-(pyridin-2-yl)oxazol-2-yl)dodecan-1-one | Drug Info | [529193] | |||
1-(5-(pyridin-2-yl)oxazol-2-yl)octadec-9-en-1-one | Drug Info | [529594] | |||
1-(5-(pyridin-2-yl)oxazol-2-yl)octan-1-one | Drug Info | [529193] | |||
1-(5-(pyridin-2-yl)oxazol-2-yl)pentan-1-one | Drug Info | [529193] | |||
1-(5-fluorooxazol-2-yl)-7-phenylheptan-1-one | Drug Info | [529193] | |||
1-(5-methyloxazol-2-yl)-7-phenylheptan-1-one | Drug Info | [529193] | |||
1-(5-phenyloxazol-2-yl)octadec-9-en-1-one | Drug Info | [529594] | |||
1-(5-Pyridin-2-yl-oxazol-2-yl)-octadec-9-yn-1-one | Drug Info | [527476] | |||
1-(oxazol-2-yl)-3-(4-phenoxyphenyl)propan-1-one | Drug Info | [529284] | |||
1-(oxazol-2-yl)-4-(piperidin-4-yl)butan-1-one | Drug Info | [529327] | |||
1-(oxazol-2-yl)-7-phenylheptan-1-one | Drug Info | [529603] | |||
1-(oxazol-2-yl)octadec-9-en-1-one | Drug Info | [529594] | |||
1-(oxazolo[4,5-b]pyridin-2-yl)dodecan-1-one | Drug Info | [529193] | |||
1-(oxazolo[4,5-b]pyridin-2-yl)octan-1-one | Drug Info | [529193] | |||
1-(oxazolo[4,5-b]pyridin-2-yl)pentan-1-one | Drug Info | [529193] | |||
1-Benzooxazol-2-yl-6-phenyl-hexan-1-one | Drug Info | [527476] | |||
1-Biphenyl-4-ylmaleimide | Drug Info | [530251] | |||
1-Biphenyl-4-ylmethylmaleimide | Drug Info | [530251] | |||
1-DODECANOL | Drug Info | [551374] | |||
1-Imidazol-1-yl-3-(4-octylphenoxy)propan-2-one | Drug Info | [530576] | |||
1-Oxazolo[4,5-b]pyridin-2-yl-6-phenyl-hexan-1-one | Drug Info | [527671] | |||
1-Oxazolo[4,5-b]pyridin-2-yl-octadec-9-yn-1-one | Drug Info | [527476] | |||
2,2-dimethyl-3-methyleneheptadecane | Drug Info | [529157] | |||
2,4-difluorophenyl 4-butoxybenzylcarbamate | Drug Info | [530604] | |||
2-(7-phenylheptanoyl)oxazole-4-carbaldehyde | Drug Info | [529603] | |||
2-(7-phenylheptanoyl)oxazole-4-carbonitrile | Drug Info | [529603] | |||
2-(7-phenylheptanoyl)oxazole-4-carboxamide | Drug Info | [529603] | |||
2-(7-phenylheptanoyl)oxazole-4-carboxylic acid | Drug Info | [529603] | |||
2-(7-phenylheptanoyl)oxazole-5-carbonitrile | Drug Info | [529603] | |||
2-(7-phenylheptanoyl)oxazole-5-carboxylic acid | Drug Info | [529603] | |||
2-(biphenyl-4-yl)vinylboronic acid | Drug Info | [529790] | |||
2-arachidonoylglycerol | Drug Info | [529031] | |||
2-chloro-1-(5-(pyridin-2-yl)oxazol-2-yl)ethanone | Drug Info | [528884] | |||
2-Cyclohexylacetic acidbiphenyl-3-yl ester | Drug Info | [529498] | |||
2-fluorophenyl 1-(4-butoxyphenyl)propylcarbamate | Drug Info | [530604] | |||
2-fluorophenyl 4'-ethylbiphenyl-4-ylcarbamate | Drug Info | [530604] | |||
2-fluorophenyl 4-(decyloxy)phenylcarbamate | Drug Info | [530604] | |||
2-fluorophenyl 4-(dodecyloxy)phenylcarbamate | Drug Info | [530604] | |||
2-fluorophenyl 4-(heptyloxy)phenylcarbamate | Drug Info | [530604] | |||
2-fluorophenyl 4-(hexyloxy)phenylcarbamate | Drug Info | [530604] | |||
2-fluorophenyl 4-(octyloxy)phenylcarbamate | Drug Info | [530604] | |||
2-fluorophenyl 4-(undecyloxy)phenylcarbamate | Drug Info | [530604] | |||
2-fluorophenyl 4-butoxybenzylcarbamate | Drug Info | [530604] | |||
2-fluorophenyl 4-butoxyphenylcarbamate | Drug Info | [530604] | |||
2-fluorophenyl 4-phenoxyphenylcarbamate | Drug Info | [530604] | |||
2-fluorophenylboronic acid | Drug Info | [529790] | |||
2-methoxyphenylboronic acid | Drug Info | [529790] | |||
3'-carbamoylbiphenyl-3-yl 6-phenylhexylcarbamate | Drug Info | [529791] | |||
3'-carbamoylbiphenyl-3-yl cyclohexylcarbamate | Drug Info | [530576] | |||
3,3-di(pent-4-enyl)azetidin-2-one | Drug Info | [529529] | |||
3-(4,5-Dihydrooxazol-2-yl)phenyl propylcarbamate | Drug Info | [530218] | |||
3-(benzo[d]oxazol-2-yl)phenyl propylcarbamate | Drug Info | [530218] | |||
3-(biphenyl-4-yl)-1-(oxazol-2-yl)propan-1-one | Drug Info | [529284] | |||
3-(decylsulfinyl)-1,1,1-trifluoropropan-2-one | Drug Info | [529157] | |||
3-(decylsulfonyl)-1,1,1-trifluoropropan-2-one | Drug Info | [529157] | |||
3-(decylthio)-1,1,1-trifluoropropan-2-one | Drug Info | [529157] | |||
3-(dodecylsulfinyl)-1,1,1-trifluoropropan-2-one | Drug Info | [529157] | |||
3-(dodecylsulfonyl)-1,1,1-trifluoropropan-2-one | Drug Info | [529157] | |||
3-(ethoxycarbonyl)phenylboronic acid | Drug Info | [529790] | |||
3-(trifluoromethyl)phenyl 4-butoxybenzylcarbamate | Drug Info | [530604] | |||
3-(trifluoromethyl)phenylboronic acid | Drug Info | [529790] | |||
3-chlorophenyl 4-butoxybenzylcarbamate | Drug Info | [530604] | |||
3-cyanophenylboronic acid | Drug Info | [529790] | |||
3-methoxyphenylboronic acid | Drug Info | [529790] | |||
4-(1,2,3-thiadiazol-4-yl)phenyl butylcarbamate | Drug Info | [529975] | |||
4-(1,2,3-thiadiazol-4-yl)phenyl hexylcarbamate | Drug Info | [529975] | |||
4-(4,5-dihydrothiazol-2-yl)phenyl butylcarbamate | Drug Info | [529975] | |||
4-(cyclohexylmethylcarbamoyloxy)benzoic acid | Drug Info | [529791] | |||
4-(thiazol-2-yl)phenyl butylcarbamate | Drug Info | [528323] | |||
4-(trifluoromethyl)phenylboronic acid | Drug Info | [529790] | |||
4-cyanophenyl ethyl dodecylphosphonate | Drug Info | [529659] | |||
4-cyanophenylboronic acid | Drug Info | [529790] | |||
4-fluorophenyl 1-(4-butoxyphenyl)propylcarbamate | Drug Info | [530604] | |||
4-fluorophenyl 4-butoxybenzylcarbamate | Drug Info | [530604] | |||
4-fluorophenylboronic acid | Drug Info | [529790] | |||
4-methoxyphenyl 1-(4-butoxyphenyl)propylcarbamate | Drug Info | [530604] | |||
4-methoxyphenylboronic acid | Drug Info | [529790] | |||
4-Nitrophenyl 4-Benzylpiperazine-1-carboxylate | Drug Info | [530654] | |||
4-nitrophenylboronic acid | Drug Info | [529790] | |||
4-nonylphenylboronic acid | Drug Info | [529790] | |||
4-Phenylbutylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
6-fluoropyridin-3-ylboronic acid | Drug Info | [529790] | |||
6-Phenylhexylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
7-Phenyl-1-(1,3,4-thiadiazol-2-yl)-heptan-1-one | Drug Info | [529594] | |||
7-Phenyl-1-(2H-tetrazol-5-yl)-heptan-1-one | Drug Info | [529594] | |||
7-phenyl-1-(4-phenyloxazol-2-yl)heptan-1-one | Drug Info | [529603] | |||
7-phenyl-1-(5-phenyloxazol-2-yl)heptan-1-one | Drug Info | [529594] | |||
7-Phenyl-1-(pyridazin-3-yl)-heptan-1-one | Drug Info | [529594] | |||
7-Phenyl-1-(thiazol-2-yl)-heptan-1-one | Drug Info | [529594] | |||
8-Phenyloctylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
Adamant-1-ylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
Allylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
AM-404 | Drug Info | [529838] | |||
AR-C70484XX | Drug Info | [530576] | |||
ARACHIDONYL TRIFLUOROMETHYLKETONE | Drug Info | [530576] | |||
Benzaldehyde O-4-(decyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Benzaldehyde O-4-(heptyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Benzaldehyde O-4-(hexyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Benzaldehyde O-4-(nonyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Benzaldehyde O-4-(octyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Benzaldehyde O-4-(pentyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Benzaldehyde O-4-butoxyphenylcarbamoyl oxime | Drug Info | [530604] | |||
Benzaldehyde O-4-ethoxyphenylcarbamoyl oxime | Drug Info | [530604] | |||
Benzaldehyde O-4-methoxyphenylcarbamoyl oxime | Drug Info | [530604] | |||
Benzaldehyde O-4-propoxyphenylcarbamoyl oxime | Drug Info | [530604] | |||
Benzofuran-2-ylboronic acid | Drug Info | [529790] | |||
Benzo[b]thiophen-2-ylboronic acid | Drug Info | [529790] | |||
Benzylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
Biphenyl-3-ylboronic acid | Drug Info | [529790] | |||
Biphenyl-3-ylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
Biphenyl-3-ylcarbamic acid cyclohexyl ester | Drug Info | [530251] | |||
Biphenyl-4-ylboronic acid | Drug Info | [529790] | |||
BMS-1 | Drug Info | [529859] | |||
BTNP | Drug Info | [529791] | |||
Chlorphrifos oxon | Drug Info | [529440] | |||
Cyclobutylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
Cyclohexyl biphenyl-4-ylcarbamate | Drug Info | [529975] | |||
Cyclohexylcarbamic acidbiphenyl-3-yl ester | Drug Info | [529498] | |||
Cyclohexylmethylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
Cyclopentyl(5-(pyridin-2-yl)oxazol-2-yl)methanone | Drug Info | [528884] | |||
Cyclopentylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
Dodecane-1-sulfonyl fluoride | Drug Info | [529659] | |||
Ethyl octylfluorophosphonate | Drug Info | [529440] | |||
Fatty acid amide hydrolase inhibitors | Drug Info | [543418] | |||
Furan-2-ylmethylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
HTS-00798 | Drug Info | [528323] | |||
Indan-2-ylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
IPI-940 | Drug Info | [543418] | |||
Isopropyl 4-nitrophenyl dodecylphosphonate | Drug Info | [529659] | |||
Isopropyl dodecylfluorophosphonate | Drug Info | [529440] | |||
Isopropylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
JNJ-1661010 | Drug Info | [529638] | |||
LY-2183240 | Drug Info | [529791] | |||
LY-2318912 | Drug Info | [528802] | |||
Methoxy arachidonyl fluorophosphonate | Drug Info | [551393] | |||
Methyl 2-(7-phenylheptanoyl)oxazole-4-carboxylate | Drug Info | [529603] | |||
Methyl 2-(7-phenylheptanoyl)oxazole-5-carboxylate | Drug Info | [529594] | |||
Methyl icosylphosphonofluoridate | Drug Info | [529659] | |||
Methylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
N-(2-hydroxyethyl)linoleoylamide | Drug Info | [529848] | |||
N-(2-iodethyl)arachidonylamide | Drug Info | [529848] | |||
N-(2-iodoethyl)linoleoylamide | Drug Info | [529848] | |||
N-(4-hydroxybenzyl)icosa-5,8,11,14-tetraenamide | Drug Info | [529838] | |||
N-arachidonylmaleimide | Drug Info | [530251] | |||
N-Butylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
N-Hexylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
N-Octylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
Naphthalen-2-yl cyclohexylcarbamate | Drug Info | [529791] | |||
NICARBAZIN | Drug Info | [530469] | |||
Nicotinaldehyde O-4-butoxyphenylcarbamoyl oxime | Drug Info | [530604] | |||
Nicotinaldehyde O-4-ethoxyphenylcarbamoyl oxime | Drug Info | [530604] | |||
Nicotinaldehyde O-4-propoxyphenylcarbamoyl oxime | Drug Info | [530604] | |||
Octane-1-sulfonyl fluoride | Drug Info | [529659] | |||
OL-135 | Drug Info | [530527] | |||
OL-92 | Drug Info | [529859] | |||
Org-231295 | Drug Info | [543418] | |||
PARAOXON | Drug Info | [529440] | |||
PF-04457845 | Drug Info | [531512] | |||
PF3845 | Drug Info | [530091] | |||
PF750 | Drug Info | [529113] | |||
Phenethylboronic acid | Drug Info | [529790] | |||
Phenethylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
PHENMEDIPHAM | Drug Info | [530469] | |||
Phenyl 1-(4-butoxyphenyl)propylcarbamate | Drug Info | [530604] | |||
Phenyl 4-(decyloxy)phenylcarbamate | Drug Info | [530604] | |||
Phenyl 4-(dodecyloxy)phenylcarbamate | Drug Info | [530604] | |||
Phenyl 4-(heptyloxy)phenylcarbamate | Drug Info | [530604] | |||
Phenyl 4-(hexyloxy)phenylcarbamate | Drug Info | [530604] | |||
Phenyl 4-(octyloxy)phenylcarbamate | Drug Info | [530604] | |||
Phenyl 4-(undecyloxy)phenylcarbamate | Drug Info | [530604] | |||
Phenyl Boronic acid | Drug Info | [529790] | |||
Phenyl-1,4-bismaleimide | Drug Info | [530251] | |||
Phenylcarbamic Acid Biphenyl-3-yl Ester | Drug Info | [529498] | |||
Propan-2-one O-3-butoxyphenylcarbamoyl oxime | Drug Info | [530604] | |||
Propan-2-one O-4-(decyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Propan-2-one O-4-(heptyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Propan-2-one O-4-(hexyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Propan-2-one O-4-(nonyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Propan-2-one O-4-(octyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Propan-2-one O-4-(pentyloxy)phenylcarbamoyl oxime | Drug Info | [530604] | |||
Propan-2-one O-4-butoxybenzylcarbamoyl oxime | Drug Info | [530604] | |||
Propan-2-one O-4-butoxyphenylcarbamoyl oxime | Drug Info | [530604] | |||
Propan-2-one O-4-ethoxyphenylcarbamoyl oxime | Drug Info | [530604] | |||
Propan-2-one O-4-propoxyphenylcarbamoyl oxime | Drug Info | [530604] | |||
Propofol | Drug Info | [535758], [536166] | |||
Pyridin-3-yl 4-butoxybenzylcarbamate | Drug Info | [530604] | |||
SSR411298 | Drug Info | [549823] | |||
Thiopental | Drug Info | [535758] | |||
VER-156084 | Drug Info | [530200] | |||
Modulator | IW-6118 | Drug Info | [544183] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Anandamide degradation | ||||
KEGG Pathway | Retrograde endocannabinoid signaling | ||||
PANTHER Pathway | Anandamide degradation | ||||
References | |||||
Ref 522544 | ClinicalTrials.gov (NCT00822744) An Eight-week Study of SSR411298 as Treatment for Major Depressive Disorder in Elderly Patients. U.S. National Institutes of Health. | ||||
Ref 523013 | ClinicalTrials.gov (NCT01107236) Study to Evaluate Efficacy and Safety of IW-6118 in Patients Undergoing Third Molar Extraction. U.S. National Institutes of Health. | ||||
Ref 525679 | Propofol in anesthesia. Mechanism of action, structure-activity relationships, and drug delivery. Curr Med Chem. 2000 Feb;7(2):249-71. | ||||
Ref 535758 | The general anesthetic propofol increases brain N-arachidonylethanolamine (anandamide) content and inhibits fatty acid amide hydrolase. Br J Pharmacol. 2003 Jul;139(5):1005-13. | ||||
Ref 538450 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011679. | ||||
Ref 539663 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2579). | ||||
Ref 540866 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5464). | ||||
Ref 526085 | Bioorg Med Chem Lett. 2001 Jun 18;11(12):1517-20.alpha-Keto heterocycle inhibitors of fatty acid amide hydrolase: carbonyl group modification and alpha-substitution. | ||||
Ref 527476 | J Med Chem. 2005 Mar 24;48(6):1849-56.Discovery of a potent, selective, and efficacious class of reversible alpha-ketoheterocycle inhibitors of fatty acid amide hydrolase effective as analgesics. | ||||
Ref 527671 | J Med Chem. 2005 Aug 11;48(16):5059-87.The endocannabinoid system: drug targets, lead compounds, and potential therapeutic applications. | ||||
Ref 528323 | J Med Chem. 2006 Jul 27;49(15):4650-6.Fatty acid amide hydrolase inhibitors from virtual screening of the endocannabinoid system. | ||||
Ref 528802 | Eur J Med Chem. 2008 Jan;43(1):62-72. Epub 2007 Mar 19.Carbamoyl tetrazoles as inhibitors of endocannabinoid inactivation: a critical revisitation. | ||||
Ref 528884 | J Med Chem. 2007 Jul 12;50(14):3359-68. Epub 2007 Jun 9.Structure-activity relationships of alpha-ketooxazole inhibitors of fatty acid amide hydrolase. | ||||
Ref 529008 | J Med Chem. 2007 Oct 4;50(20):5012-23. Epub 2007 Sep 1.Structure-activity relationship of a series of inhibitors of monoacylglycerol hydrolysis--comparison with effects upon fatty acid amide hydrolase. | ||||
Ref 529031 | Bioorg Med Chem Lett. 2007 Nov 1;17(21):5959-63. Epub 2007 Aug 21.Conformationally constrained analogues of 2-arachidonoylglycerol. | ||||
Ref 529113 | Novel mechanistic class of fatty acid amide hydrolase inhibitors with remarkable selectivity. Biochemistry. 2007 Nov 13;46(45):13019-30. Epub 2007 Oct 19. | ||||
Ref 529157 | Bioorg Med Chem. 2008 Feb 15;16(4):2114-30. Epub 2007 Nov 26.Influence of sulfur oxidation state and steric bulk upon trifluoromethyl ketone (TFK) binding kinetics to carboxylesterases and fatty acid amide hydrolase (FAAH). | ||||
Ref 529193 | Bioorg Med Chem. 2008 Feb 15;16(4):1562-95. Epub 2007 Nov 6.Inhibitors of proteases and amide hydrolases that employ an alpha-ketoheterocycle as a key enabling functionality. | ||||
Ref 529284 | J Med Chem. 2008 Feb 28;51(4):937-47. Epub 2008 Feb 5.Optimization of alpha-ketooxazole inhibitors of fatty acid amide hydrolase. | ||||
Ref 529327 | Bioorg Med Chem Lett. 2008 Mar 15;18(6):2109-13. Epub 2008 Jan 30.Novel ketooxazole based inhibitors of fatty acid amide hydrolase (FAAH). | ||||
Ref 529440 | Nat Chem Biol. 2008 Jun;4(6):373-8. Epub 2008 Apr 27.Activation of the endocannabinoid system by organophosphorus nerve agents. | ||||
Ref 529498 | J Med Chem. 2008 Jun 26;51(12):3487-98. Epub 2008 May 29.Synthesis and quantitative structure-activity relationship of fatty acid amide hydrolase inhibitors: modulation at the N-portion of biphenyl-3-yl alkylcarbamates. | ||||
Ref 529529 | Bioorg Med Chem Lett. 2008 Jul 15;18(14):4163-7. Epub 2008 May 24.3-Alkenyl-2-azetidinones as fatty acid amide hydrolase inhibitors. | ||||
Ref 529594 | J Med Chem. 2008 Aug 14;51(15):4392-403. Epub 2008 Jul 16.Optimization of the central heterocycle of alpha-ketoheterocycle inhibitors of fatty acid amide hydrolase. | ||||
Ref 529603 | Bioorg Med Chem Lett. 2008 Nov 15;18(22):5842-6. Epub 2008 Jun 28.Exploration of a fundamental substituent effect of alpha-ketoheterocycle enzyme inhibitors: Potent and selective inhibitors of fattyacid amide hydrolase. | ||||
Ref 529638 | Bioorg Med Chem Lett. 2008 Sep 1;18(17):4838-43. Epub 2008 Jul 25.Thiadiazolopiperazinyl ureas as inhibitors of fatty acid amide hydrolase. | ||||
Ref 529659 | Bioorg Med Chem Lett. 2008 Nov 15;18(22):5875-8. Epub 2008 Aug 6.Monoacylglycerol lipase regulates 2-arachidonoylglycerol action and arachidonic acid levels. | ||||
Ref 529790 | J Med Chem. 2008 Nov 27;51(22):7057-60.Discovery of boronic acids as novel and potent inhibitors of fatty acid amide hydrolase. | ||||
Ref 529791 | J Med Chem. 2008 Dec 11;51(23):7327-43.Discovery and development of fatty acid amide hydrolase (FAAH) inhibitors. | ||||
Ref 529838 | J Med Chem. 2008 Dec 25;51(24):7800-5.New analgesics synthetically derived from the paracetamol metabolite N-(4-hydroxyphenyl)-(5Z,8Z,11Z,14Z)-icosatetra-5,8,11,14-enamide. | ||||
Ref 529848 | Bioorg Med Chem. 2009 Jan 1;17(1):49-56. Epub 2008 Nov 17.Radiosynthesis, in vitro and in vivo evaluation of 123I-labeled anandamide analogues for mapping brain FAAH. | ||||
Ref 529859 | J Med Chem. 2009 Jan 8;52(1):170-80.Synthesis and evaluation of benzothiazole-based analogues as novel, potent, and selective fatty acid amide hydrolase inhibitors. | ||||
Ref 529975 | Eur J Med Chem. 2009 Jul;44(7):2994-3008. Epub 2009 Jan 20.The synthesis and biological evaluation of para-substituted phenolic N-alkyl carbamates as endocannabinoid hydrolyzing enzyme inhibitors. | ||||
Ref 530091 | Discovery and characterization of a highly selective FAAH inhibitor that reduces inflammatory pain. Chem Biol. 2009 Apr 24;16(4):411-20. | ||||
Ref 530200 | Bioorg Med Chem Lett. 2009 Aug 1;19(15):4241-4. Epub 2009 May 29.Fatty acid amide hydrolase inhibitors. Surprising selectivity of chiral azetidine ureas. | ||||
Ref 530218 | Eur J Med Chem. 2009 Oct;44(10):4179-91. Epub 2009 May 22.Chiral 3-(4,5-dihydrooxazol-2-yl)phenyl alkylcarbamates as novel FAAH inhibitors: Insight into FAAH enantioselectivity by molecular docking and interaction fields. | ||||
Ref 530251 | J Med Chem. 2009 Dec 10;52(23):7410-20.Synthesis and in vitro evaluation of N-substituted maleimide derivatives as selective monoglyceride lipase inhibitors. | ||||
Ref 530469 | Bioorg Med Chem Lett. 2009 Dec 1;19(23):6793-6. Epub 2009 Sep 30.Mining biologically-active molecules for inhibitors of fatty acid amide hydrolase (FAAH): identification of phenmedipham and amperozide as FAAH inhibitors. | ||||
Ref 530527 | J Med Chem. 2010 Jan 14;53(1):230-40.X-ray crystallographic analysis of alpha-ketoheterocycle inhibitors bound to a humanized variant of fatty acid amide hydrolase. | ||||
Ref 530576 | Bioorg Med Chem. 2010 Jan 15;18(2):945-52. Epub 2009 Nov 17.1-Indol-1-yl-propan-2-ones and related heterocyclic compounds as dual inhibitors of cytosolic phospholipase A(2)alpha and fatty acid amidehydrolase. | ||||
Ref 530604 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):1272-7. Epub 2009 Nov 24.Oxime carbamate--discovery of a series of novel FAAH inhibitors. | ||||
Ref 530654 | J Med Chem. 2010 Feb 25;53(4):1830-42.Characterization of tunable piperidine and piperazine carbamates as inhibitors of endocannabinoid hydrolases. | ||||
Ref 531512 | Discovery of PF-04457845: A Highly Potent, Orally Bioavailable, and Selective Urea FAAH Inhibitor. ACS Med Chem Lett. 2011 Feb 10;2(2):91-96. | ||||
Ref 535758 | The general anesthetic propofol increases brain N-arachidonylethanolamine (anandamide) content and inhibits fatty acid amide hydrolase. Br J Pharmacol. 2003 Jul;139(5):1005-13. | ||||
Ref 543418 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1400). |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.