Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T32578
|
||||
| Former ID |
TTDC00080
|
||||
| Target Name |
Interleukin-6
|
||||
| Gene Name |
IL6
|
||||
| Synonyms |
B-cell stimulatory factor 2; BSF-2; CDF; CTL differentiation factor; Hybridoma growth factor; IL-6; Interferon beta-2; IL6
|
||||
| Target Type |
Successful
|
||||
| Disease | Anemia [ICD9: 280-285; ICD10: D50-D64] | ||||
| Crohn's disease [ICD9: 555; ICD10: K50] | |||||
| Hematological malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Opioid-related disorders; Diabetic neuropathy [ICD9: 250, 250.6, 292, 304.0, 305.50, 356.0, 356.8; ICD10: E08-E13, E10.4, E11.4, E13.4, F11, G64, G90.0] | |||||
| Psoriatic arthritis; Rheumatoid arthritis [ICD9: 696.0, 710-719, 714; ICD10: L40.5, M00-M25, M05-M06, M07] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Function |
Cytokine with a wide variety of biologicalfunctions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig- secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.
|
||||
| BioChemical Class |
Cytokine: interleukin
|
||||
| Target Validation |
T32578
|
||||
| UniProt ID | |||||
| Sequence |
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Siltuximab | Drug Info | Approved | Anemia | [533123], [542417], [551871] |
| ALD-518 | Drug Info | Phase 2 | Psoriatic arthritis; Rheumatoid arthritis | [1572591] | |
| CDP-6038 | Drug Info | Phase 2 | Rheumatoid arthritis | [1572591] | |
| Ibudilast | Drug Info | Phase 2 | Opioid-related disorders; Diabetic neuropathy | [536374], [542420] | |
| Olokizumab | Drug Info | Phase 2 | Rheumatoid arthritis | [523674] | |
| YSIL6 | Drug Info | Phase 2 | Crohn's disease | [547912] | |
| C326 | Drug Info | Phase 1 | Crohn's disease | [521856] | |
| MEDI5117 | Drug Info | Phase 1 | Rheumatoid arthritis | [523841] | |
| OP-R003 | Drug Info | Phase 1 | Hematological malignancies | [549241] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| HIF-1 signaling pathway | |||||
| FoxO signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| Toll-like receptor signaling pathway | |||||
| NOD-like receptor signaling pathway | |||||
| Cytosolic DNA-sensing pathway | |||||
| Jak-STAT signaling pathway | |||||
| Hematopoietic cell lineage | |||||
| TNF signaling pathway | |||||
| Intestinal immune network for IgA production | |||||
| Non-alcoholic fatty liver disease (NAFLD) | |||||
| Prion diseases | |||||
| Salmonella infection | |||||
| Pertussis | |||||
| Legionellosis | |||||
| Chagas disease (American trypanosomiasis) | |||||
| African trypanosomiasis | |||||
| Malaria | |||||
| Amoebiasis | |||||
| Tuberculosis | |||||
| Hepatitis B | |||||
| Measles | |||||
| Influenza A | |||||
| HTLV-I infection | |||||
| Herpes simplex infection | |||||
| Pathways in cancer | |||||
| Transcriptional misregulation in cancer | |||||
| Inflammatory bowel disease (IBD) | |||||
| Rheumatoid arthritis | |||||
| Graft-versus-host disease | |||||
| Hypertrophic cardiomyopathy (HCM) | |||||
| NetPath Pathway | IL1 Signaling Pathway | ||||
| TWEAK Signaling Pathway | |||||
| TCR Signaling Pathway | |||||
| IL2 Signaling Pathway | |||||
| IL4 Signaling Pathway | |||||
| TGF_beta_Receptor Signaling Pathway | |||||
| TNFalpha Signaling Pathway | |||||
| Alpha6Beta4Integrin Signaling Pathway | |||||
| TSLP Signaling Pathway | |||||
| Leptin Signaling Pathway | |||||
| RANKL Signaling Pathway | |||||
| IL5 Signaling Pathway | |||||
| PANTHER Pathway | Interleukin signaling pathway | ||||
| Pathway Interaction Database | LPA receptor mediated events | ||||
| IL27-mediated signaling events | |||||
| Validated transcriptional targets of AP1 family members Fra1 and Fra2 | |||||
| SHP2 signaling | |||||
| Glucocorticoid receptor regulatory network | |||||
| amb2 Integrin signaling | |||||
| ATF-2 transcription factor network | |||||
| AP-1 transcription factor network | |||||
| IL6-mediated signaling events | |||||
| IL23-mediated signaling events | |||||
| Reactome | Interleukin-6 signaling | ||||
| MAPK3 (ERK1) activation | |||||
| MAPK1 (ERK2) activation | |||||
| Senescence-Associated Secretory Phenotype (SASP) | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| SIDS Susceptibility Pathways | |||||
| TCR Signaling Pathway | |||||
| Senescence and Autophagy in Cancer | |||||
| Cytokines and Inflammatory Response | |||||
| IL-6 signaling pathway | |||||
| Myometrial Relaxation and Contraction Pathways | |||||
| Hematopoietic Stem Cell Differentiation | |||||
| Differentiation Pathway | |||||
| Interleukin-6 signaling | |||||
| Spinal Cord Injury | |||||
| Adipogenesis | |||||
| TNF alpha Signaling Pathway | |||||
| TSLP Signaling Pathway | |||||
| TWEAK Signaling Pathway | |||||
| Folate Metabolism | |||||
| Vitamin B12 Metabolism | |||||
| Selenium Micronutrient Network | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| References | |||||
| Ref 521856 | ClinicalTrials.gov (NCT00353756) Phase 1 Study of Safety and Biological Effects of C326, an Inhibitor of IL-6, in Crohn's Disease. U.S. National Institutes of Health. | ||||
| Ref 523674 | ClinicalTrials.gov (NCT01463059) Efficacy and Safety of Olokizumab With Rheumatoid Arthritis With Previously Failed to Anti-tumor Necrosis Factor (Anti-TNF) Therapy. U.S. National Institutes of Health. | ||||
| Ref 523841 | ClinicalTrials.gov (NCT01559103) Study to Assess the Safety and Tolerability of MEDI5117 in Rheumatoid Arthritis Patients. U.S. National Institutes of Health. | ||||
| Ref 542417 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7396). | ||||
| Ref 542420 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7399). | ||||
| Ref 547912 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020380) | ||||
| Ref 549241 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034097) | ||||
| Ref 531539 | Whole-molecule antibody engineering: generation of a high-affinity anti-IL-6 antibody with extended pharmacokinetics. J Mol Biol. 2011 Aug 26;411(4):791-807. | ||||
| Ref 537252 | The molecular basis of hepcidin-resistant hereditary hemochromatosis. Blood. 2009 Jul 9;114(2):437-43. Epub 2009 Apr 21. | ||||
| Ref 544437 | Efficacy and safety of olokizumab in patients with rheumatoid arthritis with an inadequate response to TNF inhibitor therapy: outcomes of a randomised Phase IIb study. Ann Rheum Dis. 2014 September; 73(9): 1607-1615. | ||||
| Ref 547913 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020380) | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

