Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T55815
|
||||
Former ID |
TTDS00400
|
||||
Target Name |
Neuronal acetylcholinereceptor subunit alpha-2
|
||||
Gene Name |
CHRNA2
|
||||
Synonyms |
CHRNA2
|
||||
Target Type |
Successful
|
||||
Disease | Glaucoma [ICD9: 365; ICD10: H40-H42] | ||||
General anesthesia [ICD9: 338; ICD10: R20.0] | |||||
Muscle relaxant [ICD10: N39.3, N39.4, R32] | |||||
Narcotic depression [ICD9: 304.9, 311; ICD10: F19.20, F32] | |||||
Smoking withdrawl syndrom; Anesthesia [ICD9:292, 338; ICD10: F17.2, R20.0] | |||||
Spasms; Pain [ICD9: 338,780; ICD10: R52, G89] | |||||
Function |
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
|
||||
BioChemical Class |
Ion transport
|
||||
Target Validation |
T55815
|
||||
UniProt ID | |||||
Sequence |
MGPSCPVFLSFTKLSLWWLLLTPAGGEEAKRPPPRAPGDPLSSPSPTALPQGGSHTETED
RLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKL RWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYK SSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTY NSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLC ISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH TMPHWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEE DRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHL RSEDADSSVKEDWKYVAMVIDRIFLWLFIIVCFLGTIGLFLPPFLAGMI |
||||
Drugs and Mode of Action | |||||
Drug(s) | Carbachol | Drug Info | Approved | Glaucoma | [538221], [539992] |
Cisatracurium | Drug Info | Approved | Muscle relaxant | [551871] | |
Levallorphan | Drug Info | Approved | Narcotic depression | [538429], [542223] | |
Mivacurium | Drug Info | Approved | General anesthesia | [536361], [542260], [551871] | |
Pipecuronium | Drug Info | Approved | Spasms; Pain | [538529], [551871] | |
Rocuronium | Drug Info | Approved | Muscle relaxant | [551871] | |
Tubocurarine | Drug Info | Approved | Smoking withdrawl syndrom; Anesthesia | [538386], [539445], [551871] | |
Vecuronium | Drug Info | Approved | Spasms; Pain | [536361], [540619] | |
Cisatracurium | Drug Info | Phase 4 | Discovery agent | [525283] | |
Inhibitor | (S)-3-(azetidin-2-ylmethoxy)-2-fluoropyridine | Drug Info | [530178] | ||
1,1-Dimethyl-4-phenyl-piperazin-1-ium iodide | Drug Info | [527014] | |||
1-(piperidin-3-ylmethyl)pyridin-2(1H)-one | Drug Info | [528157] | |||
1-(piperidin-4-ylmethyl)pyridin-2(1H)-one | Drug Info | [528157] | |||
2-Pyridin-3-yl-7-aza-bicyclo[2.2.1]heptane | Drug Info | [527015] | |||
3-((S)-Azetidin-2-yloxy)-5-iodo-pyridine | Drug Info | [527014] | |||
5-(1-Methyl-pyrrolidin-2-yl)-2-phenethyl-pyridine | Drug Info | [527574] | |||
CHOLINE | Drug Info | [527014] | |||
CYTISINE | Drug Info | [528157] | |||
Antagonist | Carbachol | Drug Info | [536781] | ||
Cisatracurium | Drug Info | [536781], [537286] | |||
Levallorphan | Drug Info | [536781] | |||
Mivacurium | Drug Info | [537286] | |||
Pipecuronium | Drug Info | [536781] | |||
Rocuronium | Drug Info | [536781], [537286] | |||
Tubocurarine | Drug Info | [536781], [537286] | |||
Vecuronium | Drug Info | [536781], [537286] | |||
Modulator (allosteric modulator) | LY2087101 | Drug Info | [528221] | ||
Agonist | [125I]epibatidine | Drug Info | [543841] | ||
[3H]cytisine | Drug Info | [543841] | |||
[3H]epibatidine | Drug Info | [543841] | |||
Pathways | |||||
KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
PANTHER Pathway | Nicotinic acetylcholine receptor signaling pathway | ||||
Reactome | Highly calcium permeable postsynaptic nicotinic acetylcholine receptors | ||||
Highly calcium permeable nicotinic acetylcholine receptors | |||||
WikiPathways | Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | ||||
References | |||||
Ref 525283 | ClinicalTrials.gov (NCT02518789) Effects and Mechanism of Pretreatment With Dexmedetomidine to Etomidate Induce Myoclonus. | ||||
Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
Ref 538221 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070292. | ||||
Ref 538386 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 005657. | ||||
Ref 538429 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010423. | ||||
Ref 538529 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 019638. | ||||
Ref 539445 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2294). | ||||
Ref 539992 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 298). | ||||
Ref 540619 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4002). | ||||
Ref 542223 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7209). | ||||
Ref 527014 | Bioorg Med Chem Lett. 2004 Apr 19;14(8):1845-8.Pharmacology of the agonist binding sites of rat neuronal nicotinic receptor subtypes expressed in HEK 293 cells. | ||||
Ref 527015 | Bioorg Med Chem Lett. 2004 Apr 19;14(8):1889-96.Epibatidine structure-activity relationships. | ||||
Ref 527574 | Bioorg Med Chem Lett. 2005 Jul 1;15(13):3237-40.6-(2-Phenylethyl)nicotine: a novel nicotinic cholinergic receptor ligand. | ||||
Ref 528157 | J Med Chem. 2006 May 4;49(9):2673-6.Synthesis and pharmacological evaluation of novel 9- and 10-substituted cytisine derivatives. Nicotinic ligands of enhanced subtype selectivity. | ||||
Ref 528221 | Identification and pharmacological profile of a new class of selective nicotinic acetylcholine receptor potentiators. J Pharmacol Exp Ther. 2006 Sep;318(3):1108-17. Epub 2006 May 31. | ||||
Ref 530178 | Bioorg Med Chem. 2009 Jul 1;17(13):4367-77. Epub 2009 May 15.Synthesis and biological evaluation of novel carbon-11 labeled pyridyl ethers: candidate ligands for in vivo imaging of alpha4beta2 nicotinic acetylcholine receptors (alpha4beta2-nAChRs) in the brain with positron emission tomography. | ||||
Ref 536781 | Synergy between pairs of competitive antagonists at adult human muscle acetylcholine receptors. Anesth Analg. 2008 Aug;107(2):525-33. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.