Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T87075
|
||||
| Former ID |
TTDS00473
|
||||
| Target Name |
T-cell surface glycoprotein CD3 epsilon chain
|
||||
| Gene Name |
CD3E
|
||||
| Synonyms |
CD3e; T-cell surface antigen T3/Leu-4 epsilon chain; T3E; CD3E
|
||||
| Target Type |
Successful
|
||||
| Disease | Advanced breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
| Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
| Melanoma [ICD9: 172; ICD10: C43] | |||||
| Organ rejection [ICD9: 279.5, 996; ICD10: D89.8, T86] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
The CD3 complex mediates signal transduction.
|
||||
| Target Validation |
T87075
|
||||
| UniProt ID | |||||
| Sequence |
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP PPVPNPDYEPIRKGQRDLYSGLNQRRI |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Muromonab | Drug Info | Approved | Organ rejection | [536361] |
| Ertumaxomab | Drug Info | Phase 2 | Breast cancer | [529707], [531972] | |
| Resimmune | Drug Info | Phase 1/2 | Melanoma | [549482] | |
| Autologous T-cell therapy | Drug Info | Phase 1 | Prostate cancer | [525412] | |
| Ertumaxomab | Drug Info | Phase 1 | Advanced breast cancer | [889343] | |
| MT-110 | Drug Info | Phase 1 | Solid tumours | [531707] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Hematopoietic cell lineage | ||||
| T cell receptor signaling pathway | |||||
| Chagas disease (American trypanosomiasis) | |||||
| Measles | |||||
| HTLV-I infection | |||||
| Primary immunodeficiency | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| Leptin Signaling Pathway | |||||
| PANTHER Pathway | T cell activation | ||||
| Pathway Interaction Database | TCR signaling in na& | ||||
| #xef | |||||
| ve CD4+ T cells | |||||
| IL12-mediated signaling events | |||||
| TCR signaling in na& | |||||
| ve CD8+ T cells | |||||
| CXCR4-mediated signaling events | |||||
| IL23-mediated signaling events | |||||
| Downstream signaling in na& | |||||
| IL12 signaling mediated by STAT4 | |||||
| Reactome | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
| Phosphorylation of CD3 and TCR zeta chains | |||||
| Translocation of ZAP-70 to Immunological synapse | |||||
| Generation of second messenger molecules | |||||
| PD-1 signaling | |||||
| WikiPathways | TCR Signaling Pathway | ||||
| TCR signaling | |||||
| Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| Costimulation by the CD28 family | |||||
| References | |||||
| Ref 525412 | Clinical application of genetically modified T cells in cancer therapy. Clin Transl Immunology. 2014 May 16;3(5):e16. doi: 10.1038/cti.2014.7. eCollection 2014. | ||||
| Ref 529707 | Ertumaxomab: a trifunctional antibody for breast cancer treatment. Expert Opin Investig Drugs. 2008 Oct;17(10):1553-8. | ||||
| Ref 531707 | EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74. | ||||
| Ref 531972 | Trifunctional antibody ertumaxomab: Non-immunological effects on Her2 receptor activity and downstream signaling. MAbs. 2012 Sep-Oct;4(5):614-22. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 529707 | Ertumaxomab: a trifunctional antibody for breast cancer treatment. Expert Opin Investig Drugs. 2008 Oct;17(10):1553-8. | ||||
| Ref 531707 | EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74. | ||||
| Ref 531972 | Trifunctional antibody ertumaxomab: Non-immunological effects on Her2 receptor activity and downstream signaling. MAbs. 2012 Sep-Oct;4(5):614-22. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

