Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T30040
|
||||
Former ID |
TTDR00926
|
||||
Target Name |
Vascular endothelial growth factor B
|
||||
Gene Name |
VEGFB
|
||||
Synonyms |
VEGF-B; VEGF-related factor; VRF; VEGFB
|
||||
Target Type |
Successful
|
||||
Disease | Metastatic colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | ||||
Function |
Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
|
||||
BioChemical Class |
PDGF VEGF growth factor
|
||||
UniProt ID | |||||
Sequence |
MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP STTSALTPGPAAAAADAAASSVAKGGA |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Ras signaling pathway | ||||
Rap1 signaling pathway | |||||
Cytokine-cytokine receptor interaction | |||||
PI3K-Akt signaling pathway | |||||
Focal adhesion | |||||
Pathways in cancer | |||||
NetPath Pathway | TSH Signaling Pathway | ||||
Pathway Interaction Database | VEGFR1 specific signals | ||||
Reactome | Platelet degranulation | ||||
VEGF ligand-receptor interactions | |||||
VEGF binds to VEGFR leading to receptor dimerization | |||||
WikiPathways | Focal Adhesion | ||||
Signaling by VEGF | |||||
Heart Development | |||||
References |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.