Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T16987
|
||||
| Former ID |
TTDR00212
|
||||
| Target Name |
Carbonic anhydrase XII
|
||||
| Gene Name |
CA12
|
||||
| Synonyms |
CA-XII; Carbonate dehydratase XII; Tumor antigen HOM-RCC-3.1.3; CA12
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Function |
Reversible hydration of carbon dioxide.
|
||||
| BioChemical Class |
Carbon-oxygen lyases
|
||||
| Target Validation |
T16987
|
||||
| UniProt ID | |||||
| EC Number |
EC 4.2.1.1
|
||||
| Sequence |
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | MAFENIDE | Drug Info | Approved | Bacterial infection | [530765] |
| SALICYLATE | Drug Info | Phase 4 | Discovery agent | [524105] | |
| Curcumin | Drug Info | Phase 3 | Cancer | [532348], [542031] | |
| PARABEN | Drug Info | Phase 3 | Discovery agent | [524059] | |
| PHENOL | Drug Info | Phase 2/3 | Discovery agent | [525296] | |
| COUMATE | Drug Info | Phase 2 | Breast cancer | [531371] | |
| Inhibitor | 1,4-Dihydro-1-methyl-4-oxo-3-pyridinesulfonamide | Drug Info | [530978] | ||
| 1-Benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide | Drug Info | [530978] | |||
| 2,2,2-Trifluoro-N-(4-sulfamoyl-phenyl)-acetamide | Drug Info | [527743] | |||
| 2,2-Dimethyl-N-(4-sulfamoyl-phenyl)-propionamide | Drug Info | [527743] | |||
| 2,3-dihydro-1H-indene-5-sulfonamide | Drug Info | [529417] | |||
| 2,4-Disulfamyltrifluoromethylaniline | Drug Info | [527407] | |||
| 2-acetamido-2,3-dihydro-1H-indene-5-sulfonic acid | Drug Info | [529417] | |||
| 2-amino-2,3-dihydro-1H-indene-5-sulfonamide | Drug Info | [529417] | |||
| 2-Amino-benzenesulfonamide | Drug Info | [527407] | |||
| 2-Amino-indan-5-sulfonic acid | Drug Info | [529417] | |||
| 2-hydrazinylbenzenesulfonamide | Drug Info | [527407] | |||
| 2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
| 2-oxo-2H-thiochromene-3-carboxylic acid | Drug Info | [530514] | |||
| 3-((4-aminophenyl)diazenyl)benzenesulfonamide | Drug Info | [530399] | |||
| 3-((4-hydroxyphenyl)diazenyl)benzenesulfonamide | Drug Info | [530399] | |||
| 3-(3-Phenyl-ureido)-benzenesulfonamide | Drug Info | [527743] | |||
| 3-(4'-Hydroxyphenyl)diazenylbenzenesulfonamide | Drug Info | [530399] | |||
| 3-Amino-benzenesulfonamide | Drug Info | [527654] | |||
| 4,4'-thiodipyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-((4-hydroxyphenyl)diazenyl)benzenesulfonamide | Drug Info | [530399] | |||
| 4-(2-Amino-ethyl)-benzenesulfonamide | Drug Info | [527407] | |||
| 4-(2-Hydroxy-ethyl)-benzenesulfonamide | Drug Info | [527407] | |||
| 4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(2-Propynylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-(4'-N-Methylphenyl)diazenylbenzenesulfonamide | Drug Info | [530399] | |||
| 4-(4-Cyanophenoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(4-Fluorophenoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(Allylamino)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(Carbamolymethylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-(Cyanomethylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-(hydroxymethyl)benzenesulfonamide | Drug Info | [527407] | |||
| 4-(Methylhydrazino)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(N-Methyl-hydrazino)-benzenesulfonamide | Drug Info | [527407] | |||
| 4-(N-Oxide-2-pyridylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-(Quinolinoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-Amino-3-bromo-benzenesulfonamide | Drug Info | [527407] | |||
| 4-Amino-3-chloro-benzenesulfonamide | Drug Info | [527407] | |||
| 4-Amino-3-fluoro-benzenesulfonamide | Drug Info | [527407] | |||
| 4-Amino-3-iodo-benzenesulfonamide | Drug Info | [527407] | |||
| 4-Benzenesulfonylamino-benzenesulfonamide | Drug Info | [527743] | |||
| 4-Benzythiopyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-CYANOPHENOL | Drug Info | [529562] | |||
| 4-Ethoxy-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-Hydrazino-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-Hydrazino-benzenesulfonamide | Drug Info | [527654] | |||
| 4-Methanesulfonylamino-benzenesulfonamide | Drug Info | [527743] | |||
| 4-Methoxy-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-Methylamino-benzenesulfonamide | Drug Info | [527407] | |||
| 4-Methylthiopyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-[2-(3-Phenyl-ureido)-ethyl]-benzenesulfonamide | Drug Info | [527743] | |||
| 5-amino-1,3,4-thiadiazole-2-sulfonamide | Drug Info | [531013] | |||
| 6-(aminomethyl)-2H-chromen-2-one | Drug Info | [530514] | |||
| 6-(hydroxymethyl)-2H-chromen-2-one | Drug Info | [530514] | |||
| 6-Hydroxy-benzothiazole-2-sulfonic acid amide | Drug Info | [527407] | |||
| 6-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
| 6-methyl-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
| 7-(benzyloxy)-2H-chromen-2-one | Drug Info | [530514] | |||
| 7-butoxy-2H-chromen-2-one | Drug Info | [530514] | |||
| 7-methoxy-2-oxo-2H-chromene-4-carboxylic acid | Drug Info | [530514] | |||
| 7-phenethoxy-2H-chromen-2-one | Drug Info | [530514] | |||
| 7-propoxy-2H-chromen-2-one | Drug Info | [530514] | |||
| 8-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
| ACETYLSULFANILAMIDE | Drug Info | [527743] | |||
| BENZOLAMIDE | Drug Info | [527407] | |||
| Carzenide | Drug Info | [527407] | |||
| CATECHIN | Drug Info | [531068] | |||
| CATECHOL | Drug Info | [530751] | |||
| COUMARIN | Drug Info | [530514] | |||
| COUMATE | Drug Info | [529605] | |||
| Curcumin | Drug Info | [531068] | |||
| Decane-1,10-diyl disulfamate | Drug Info | [530359] | |||
| Decyl sulfamate | Drug Info | [530359] | |||
| ELLAGIC ACID | Drug Info | [530751] | |||
| ETHOXYCOUMARIN | Drug Info | [530514] | |||
| Ethyl 7-methoxy-2-oxo-2H-chromene-3-carboxylate | Drug Info | [530514] | |||
| FERULIC ACID | Drug Info | [530751] | |||
| GALLICACID | Drug Info | [530751] | |||
| HERNIARIN | Drug Info | [530514] | |||
| Hexane-1,6-diamine | Drug Info | [530998] | |||
| MAFENIDE | Drug Info | [530765] | |||
| N-(4-cyanophenyl)sulfamide | Drug Info | [527520] | |||
| N-(4-Sulfamoyl-phenyl)-benzamide | Drug Info | [527743] | |||
| N-(4-Sulfamoyl-phenyl)-butyramide | Drug Info | [527743] | |||
| N-(4-Sulfamoyl-phenyl)-isobutyramide | Drug Info | [527743] | |||
| N-(4-Sulfamoyl-phenyl)-propionamide | Drug Info | [527743] | |||
| N-(pentafluorophenyl)sulfamide | Drug Info | [527520] | |||
| N-hydroxysulfamide | Drug Info | [530922] | |||
| N-propynyl amidebenzenesulphonide | Drug Info | [528574] | |||
| N1-(2-aminoethyl)ethane-1,2-diamine | Drug Info | [530998] | |||
| N1-(naphthalen-1-yl)ethane-1,2-diamine | Drug Info | [530998] | |||
| Octane-1,8-diyl disulfamate | Drug Info | [530359] | |||
| Octyl sulfamate | Drug Info | [530359] | |||
| P-Coumaric Acid | Drug Info | [530751] | |||
| P-TOLUENESULFONAMIDE | Drug Info | [527407] | |||
| PARABEN | Drug Info | [530751] | |||
| Pentane-1,5-diamine | Drug Info | [530998] | |||
| Pentanoic acid (4-sulfamoyl-phenyl)-amide | Drug Info | [527743] | |||
| PHENOL | Drug Info | [531068] | |||
| Prop-2-ynyl 4-sulfamoylbenzoate | Drug Info | [528574] | |||
| RESORCINOL | Drug Info | [529562] | |||
| SACCHARIN | Drug Info | [529179] | |||
| SALICYLATE | Drug Info | [529562] | |||
| Sodium N-methylphenylaminomethanesulfonate | Drug Info | [530399] | |||
| Sodium phenylaminomethanesulfonate | Drug Info | [530399] | |||
| Sulfanilamide derivative | Drug Info | [527560] | |||
| Syringic Acid | Drug Info | [530751] | |||
| Thioureido sulfonamide | Drug Info | [527655] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Nitrogen metabolism | ||||
| NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
| Reactome | Reversible hydration of carbon dioxide | ||||
| WikiPathways | Reversible Hydration of Carbon Dioxide | ||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in leukocytes - TarBase | |||||
| miR-targeted genes in epithelium - TarBase | |||||
| References | |||||
| Ref 524059 | ClinicalTrials.gov (NCT01688479) Trial Comparing Calendula Officinalis With Aqueous Cream "Essex" to Treat Skin Reactions From Radiotherapy of Breast Cancer. U.S. National Institutes of Health. | ||||
| Ref 524105 | ClinicalTrials.gov (NCT01712295) 17% Salicylate Versus 17% Salicylate-Ethyl Pyruvate for Plantar Foot Warts. U.S. National Institutes of Health. | ||||
| Ref 525296 | ClinicalTrials.gov (NCT02527187) Determination of the Sensitivity and Specificity of Prick Test Betula Verrucosa. | ||||
| Ref 530765 | J Med Chem. 2010 Apr 8;53(7):2913-26.Sulfonamide linked neoglycoconjugates--a new class of inhibitors for cancer-associated carbonic anhydrases. | ||||
| Ref 531371 | Irosustat: a first-generation steroid sulfatase inhibitor in breast cancer. Expert Rev Anticancer Ther. 2011 Feb;11(2):179-83. | ||||
| Ref 527407 | Bioorg Med Chem Lett. 2005 Feb 15;15(4):963-9.Carbonic anhydrase inhibitors. Inhibition of the transmembrane isozyme XII with sulfonamides-a new target for the design of antitumor and antiglaucoma drugs?. | ||||
| Ref 527520 | Bioorg Med Chem Lett. 2005 May 2;15(9):2353-8.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with N-hydroxysulfamides--a new zinc-binding function in the design of inhibitors. | ||||
| Ref 527560 | Bioorg Med Chem Lett. 2005 Jun 15;15(12):3096-101.Carbonic anhydrase inhibitors. Inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with Schiff's bases incorporating chromone and aromatic sulfonamide moieties, and their zinc complexes. | ||||
| Ref 527654 | Bioorg Med Chem Lett. 2005 Sep 1;15(17):3828-33.Carbonic anhydrase inhibitors: inhibition of the transmembrane isozyme XIV with sulfonamides. | ||||
| Ref 527655 | Bioorg Med Chem Lett. 2005 Sep 1;15(17):3821-7.Carbonic anhydrase inhibitors: design of thioureido sulfonamides with potent isozyme II and XII inhibitory properties and intraocular pressure lowering activity in a rabbit model of glaucoma. | ||||
| Ref 527743 | Bioorg Med Chem Lett. 2005 Nov 1;15(21):4862-6.Carbonic anhydrase inhibitors: inhibition of the tumor-associated isozymes IX and XII with a library of aromatic and heteroaromatic sulfonamides. | ||||
| Ref 528574 | Bioorg Med Chem Lett. 2007 Feb 15;17(4):987-92. Epub 2006 Nov 17.Inhibition of membrane-associated carbonic anhydrase isozymes IX, XII and XIV with a library of glycoconjugate benzenesulfonamides. | ||||
| Ref 529179 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):836-41. Epub 2007 Nov 13.Carbonic anhydrase inhibitors: copper(II) complexes of polyamino-polycarboxylamido aromatic/heterocyclic sulfonamides are very potentinhibitors of the tumor-associated isoforms IX and XII. | ||||
| Ref 529417 | Eur J Med Chem. 2008 Dec;43(12):2853-60. Epub 2008 Feb 29.Indanesulfonamides as carbonic anhydrase inhibitors and anticonvulsant agents: structure-activity relationship and pharmacological evaluation. | ||||
| Ref 529562 | Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. Epub 2008 Jun 13.Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. | ||||
| Ref 529605 | Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. Epub 2008 Jul 5.Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-ray crystallographic studies. | ||||
| Ref 530359 | J Med Chem. 2009 Oct 8;52(19):5990-8.Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors. | ||||
| Ref 530399 | Bioorg Med Chem. 2009 Oct 15;17(20):7093-9. Epub 2009 Sep 6.Carbonic anhydrase inhibitors. Diazenylbenzenesulfonamides are potent and selective inhibitors of the tumor-associated isozymes IX and XIIover the cytosolic isoforms I and II. | ||||
| Ref 530514 | J Med Chem. 2010 Jan 14;53(1):335-44.Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. | ||||
| Ref 530751 | Bioorg Med Chem. 2010 Mar 15;18(6):2159-64. Epub 2010 Feb 6.Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. | ||||
| Ref 530765 | J Med Chem. 2010 Apr 8;53(7):2913-26.Sulfonamide linked neoglycoconjugates--a new class of inhibitors for cancer-associated carbonic anhydrases. | ||||
| Ref 530766 | Eur J Med Chem. 2010 Jun;45(6):2396-404. Epub 2010 Feb 12.Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associated) and XIV with 4-substituted 3-pyridinesulfonamides. | ||||
| Ref 530922 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5. Epub 2010 Apr 28.Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mammalian isoforms I-XV. | ||||
| Ref 530978 | Eur J Med Chem. 2010 Sep;45(9):3656-61. Epub 2010 May 12.Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the human cytosolic isozymes I and II and transmembrane cancer-associated isozymes IX and XII. | ||||
| Ref 530998 | J Med Chem. 2010 Aug 12;53(15):5511-22.Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. | ||||
| Ref 531013 | Bioorg Med Chem Lett. 2010 Aug 1;20(15):4376-81. Epub 2010 Jun 17.Carbonic anhydrase inhibitors. The X-ray crystal structure of human isoform II in adduct with an adamantyl analogue of acetazolamideresides in a less utilized binding pocket than most hydrophobic inhibitors. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

