Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T30823
|
||||
| Former ID |
TTDR00202
|
||||
| Target Name |
M-phase inducer phosphatase 1
|
||||
| Gene Name |
CDC25A
|
||||
| Synonyms |
Cdc25A phosphatase; Dual specificity phosphatase Cdc25A; CDC25A
|
||||
| Target Type |
Discontinued
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Function |
Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Directly dephosphorylates CDK1 and stimulates its kinase activity. Also dephosphorylates CDK2 incomplex with cyclin E, in vitro.
|
||||
| BioChemical Class |
Phosphoric monoester hydrolases
|
||||
| Target Validation |
T30823
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.1.3.48
|
||||
| Sequence |
MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | (E)-2-(1-decyl-2-oxoindolin-3-ylidene)acetic acid | Drug Info | [529444] | ||
| (Z)-2-(1-decyl-2-oxoindolin-3-ylidene)acetic acid | Drug Info | [529444] | |||
| 1-dodecyl-1H-indole-2,3-dione | Drug Info | [529444] | |||
| 2-(1-dodecyl-1H-indol-3-yl)acetic acid | Drug Info | [529444] | |||
| 3-isopropyl-4-(phenylamino)naphthalene-1,2-dione | Drug Info | [527986] | |||
| 3-isopropyl-4-(phenylthio)naphthalene-1,2-dione | Drug Info | [527986] | |||
| 3-isopropyl-4-phenylnaphthalene-1,2-dione | Drug Info | [527986] | |||
| 3-isopropylnaphthalene-1,2-dione | Drug Info | [527986] | |||
| 4-(p-toluidino)-3-isopropylnaphthalene-1,2-dione | Drug Info | [527986] | |||
| MX-7065 | Drug Info | [551830] | |||
| Naphthoquinone analogs | Drug Info | [535050] | |||
| NSC-95397 | Drug Info | [530189] | |||
| Pathways | |||||
| KEGG Pathway | Cell cycle | ||||
| Progesterone-mediated oocyte maturation | |||||
| MicroRNAs in cancer | |||||
| NetPath Pathway | IL4 Signaling Pathway | ||||
| TGF_beta_Receptor Signaling Pathway | |||||
| Pathway Interaction Database | E2F transcription factor network | ||||
| ATR signaling pathway | |||||
| Validated targets of C-MYC transcriptional activation | |||||
| ATM pathway | |||||
| Reactome | E2F mediated regulation of DNA replication | ||||
| G0 and Early G1 | |||||
| Polo-like kinase mediated events | |||||
| Cyclin B2 mediated events | |||||
| Activation of ATR in response to replication stress | |||||
| Cyclin E associated events during G1/S transition | |||||
| G1/S-Specific Transcription | |||||
| Cyclin A/B1 associated events during G2/M transition | |||||
| Ubiquitin Mediated Degradation of Phosphorylated Cdc25A | |||||
| Cdk2-associated events at S phase entry | |||||
| WikiPathways | DNA Damage Response | ||||
| G1 to S cell cycle control | |||||
| S Phase | |||||
| ATM Signaling Pathway | |||||
| Retinoblastoma (RB) in Cancer | |||||
| Prostate Cancer | |||||
| Integrated Breast Cancer Pathway | |||||
| Integrated Cancer pathway | |||||
| Mitotic G1-G1/S phases | |||||
| Cell Cycle | |||||
| Cell Cycle Checkpoints | |||||
| miRNAs involved in DNA damage response | |||||
| miRNA Regulation of DNA Damage Response | |||||
| References | |||||
| Ref 527986 | Bioorg Med Chem Lett. 2006 Apr 1;16(7):1905-8. Epub 2006 Jan 24.Synthesis of miltirone analogues as inhibitors of Cdc25 phosphatases. | ||||
| Ref 529444 | Bioorg Med Chem Lett. 2008 Jun 1;18(11):3350-3. Epub 2008 Apr 15.Design and synthesis of N-alkyl oxindolylidene acetic acids as a new class of potent Cdc25A inhibitors. | ||||
| Ref 530189 | Bioorg Med Chem Lett. 2009 Aug 1;19(15):4330-4. Epub 2009 May 27.Structure-based de novo design and biochemical evaluation of novel Cdc25 phosphatase inhibitors. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

