Target General Infomation
Target ID
T63595
Former ID
TTDR00518
Target Name
High mobility group protein 1
Gene Name
HMGB1
Synonyms
HMG-1; High mobility group box chromosomal protein 1; HMGB1
Target Type
Research
Function
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells (By similarity).
BioChemical Class
High mobility group box
UniProt ID
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Inhibitor Beta-Mercaptoethanol Drug Info [551393]
Pathways
KEGG Pathway Base excision repair
NetPath Pathway TSH Signaling Pathway
TCR Signaling Pathway
PANTHER Pathway p53 pathway
Pathway Interaction Database Beta3 integrin cell surface interactions
amb2 Integrin signaling
Endogenous TLR signaling
Reactome RIP-mediated NFkB activation via ZBP1
Activation of DNA fragmentation factor
DEx/H-box helicases activate type I IFN and inflammatory cytokines production
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
Advanced glycosylation endproduct receptor signaling
TRAF6 mediated NF-kB activation
WikiPathways DNA Damage Response (only ATM dependent)
Cytosolic sensors of pathogen-associated DNA
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
Retinoblastoma (RB) in Cancer
RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways
Apoptotic execution phase
Advanced glycosylation endproduct receptor signaling
References
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.