Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T16650
|
||||
Former ID |
TTDR00389
|
||||
Target Name |
Glycoprotein hormones alpha chain
|
||||
Gene Name |
CGA
|
||||
Synonyms |
CG-alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin alpha subunit; FSH-alpha; Follicle-stimulating hormone alpha chain; Follitropin alpha chain; LSH-alpha; Luteinizing hormone alpha chain; Lutropin alpha chain; TSH-alpha; Thyroid-stimulating hormone alpha chain; Thyrotropin alpha chain; CGA
|
||||
Target Type |
Research
|
||||
BioChemical Class |
Glycoprotein hormones
|
||||
UniProt ID | |||||
Sequence |
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
||||
Pathways | |||||
KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
GnRH signaling pathway | |||||
Ovarian steroidogenesis | |||||
Prolactin signaling pathway | |||||
Thyroid hormone synthesis | |||||
Autoimmune thyroid disease | |||||
PANTHER Pathway | Thyrotropin-releasing hormone receptor signaling pathway | ||||
Pathway Interaction Database | Glucocorticoid receptor regulatory network | ||||
PathWhiz Pathway | Intracellular Signalling Through FSH Receptor and Follicle Stimulating Hormone | ||||
Intracellular Signalling Through LHCGR Receptor and Luteinizing Hormone/Choriogonadotropin | |||||
Reactome | Androgen biosynthesis | ||||
Thyroxine biosynthesis | |||||
Hormone ligand-binding receptors | |||||
G alpha (s) signalling events | |||||
WikiPathways | Metabolism of steroid hormones and vitamin D | ||||
Metabolism of amino acids and derivatives | |||||
Peptide hormone biosynthesis | |||||
FSH signaling pathway | |||||
TSH signaling pathway | |||||
Thyroxine (Thyroid Hormone) Production | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.