Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T14834
|
||||
Former ID |
TTDR00443
|
||||
Target Name |
Cytosolic phospholipase A2
|
||||
Gene Name |
PLA2G4A
|
||||
Synonyms |
CPLA2; Phospholipase A2 group IVA; PLA2G4A
|
||||
Target Type |
Discontinued
|
||||
Disease | Asthma [ICD10: J45] | ||||
Function |
Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory response.
|
||||
BioChemical Class |
Carboxylic ester hydrolase
|
||||
Target Validation |
T14834
|
||||
UniProt ID | |||||
EC Number |
EC 3.1.1.5
|
||||
Sequence |
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETE EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR QNPSRCSVSLSNVEARRFFNKEFLSKPKA |
||||
Drugs and Mode of Action | |||||
Inhibitor | (S)-Ethyl 6-(2-oxohexadecanamido)decanoate | Drug Info | [529795] | ||
(S)-Methyl 4-(2-oxohexadecanamido)octanoate | Drug Info | [529795] | |||
(S)-tert-Butyl 4-(2-oxohexadecanamido)pentanoate | Drug Info | [529795] | |||
(Z)-1,1,1,2,2,3,3-heptafluorohenicos-12-en-4-one | Drug Info | [530831] | |||
1,1,1,2,2,3,3,5-octafluoro-8-phenyloctan-4-one | Drug Info | [530831] | |||
1,1,1,2,2,3,3-heptafluoro-8-phenyloctan-4-ol | Drug Info | [530831] | |||
1,1,1,2,2,4-hexafluoro-7-phenylheptan-3-one | Drug Info | [530831] | |||
1,1,1,2,2-Pentafluoro-8-phenyl-octan-3-one | Drug Info | [529843] | |||
1,1,1,2,2-Pentafluoro-9-phenyl-nonan-3-one | Drug Info | [529843] | |||
1,1,1,3-Tetrafluoro-6-phenylhexan-2-one | Drug Info | [530831] | |||
1,1,1,3-Tetrafluoro-7-phenylheptan-2-one | Drug Info | [530831] | |||
1,1,1,3-Tetrafluoro-heptadecan-2-one | Drug Info | [529843] | |||
1,1,1-Trifluoro-4-(4-hexyloxy-phenyl)-butan-2-one | Drug Info | [529843] | |||
1,1,1-Trifluoro-5-(4-octylphenoxy)pentan-2-one | Drug Info | [530831] | |||
1,1,1-Trifluoro-6-(4-hexyloxy-phenyl)-hexan-2-one | Drug Info | [529843] | |||
1,1,1-Trifluoro-6-(naphthalen-2-yl)hexan-2-one | Drug Info | [530831] | |||
1,1,1-Trifluoro-7-phenylheptan-2-one | Drug Info | [529843] | |||
1,1,1-Trifluoro-8-phenyl-octan-2-one | Drug Info | [529843] | |||
1,1,1-trifluoroheptadecan-2-one | Drug Info | [529843] | |||
1-Imidazol-1-yl-3-(4-octylphenoxy)propan-2-one | Drug Info | [530576] | |||
4-(2-oxohexadecanamido)butanoic acid | Drug Info | [528680] | |||
4-(4-Decyloxy-phenyl)-1,1,1-trifluoro-butan-2-one | Drug Info | [529843] | |||
6-(4-Decyloxy-phenyl)-1,1,1-trifluoro-hexan-2-one | Drug Info | [529843] | |||
Allyl 4-(2-oxohexadecanamido)butanoate | Drug Info | [529795] | |||
AR-C70484XX | Drug Info | [530576] | |||
ARACHIDONYL TRIFLUOROMETHYLKETONE | Drug Info | [530576] | |||
Arachidonyltrifluoromethyl ketone | Drug Info | [535403] | |||
AX-006 | Drug Info | [530139] | |||
AX-048 | Drug Info | [530139] | |||
ECOPLADIB | Drug Info | [529940] | |||
EFIPLADIB | Drug Info | [529940] | |||
Ethyl 2-(2-oxohexadecanamido)acetate | Drug Info | [529795] | |||
Ethyl 4-(2-oxohexadecanamido)benzoate | Drug Info | [529795] | |||
Methyl 2-(2-oxo-8-phenyloctanamido)acetate | Drug Info | [529795] | |||
Methyl 2-(2-oxohexadecanamido)acetate | Drug Info | [529795] | |||
Methyl arachidonyl fluorophosphonate | Drug Info | [535403] | |||
N-(4-Ethoxybutyl)-2-oxohexadecanamide | Drug Info | [529795] | |||
Tert-Butyl 2-(2-oxohexadecanamido)acetate | Drug Info | [529795] | |||
Tert-Butyl 3-(2-oxo-8-phenyloctanamido)propanoate | Drug Info | [529795] | |||
Tert-Butyl 3-(2-oxohexadecanamido)propanoate | Drug Info | [529795] | |||
Tert-Butyl 5-(2-oxohexadecanamido)pentanoate | Drug Info | [529795] | |||
WAY-196025 | Drug Info | [529940] | |||
[3,4''']biflavone | Drug Info | [529028] | |||
[4',4''']-biflavone | Drug Info | [529028] | |||
[6,3''']biflavone | Drug Info | [529028] | |||
[6,4''']biflavone | Drug Info | [529028] | |||
Pathways | |||||
BioCyc Pathway | Phospholipases | ||||
KEGG Pathway | Glycerophospholipid metabolism | ||||
Ether lipid metabolism | |||||
Arachidonic acid metabolism | |||||
Linoleic acid metabolism | |||||
alpha-Linolenic acid metabolism | |||||
Metabolic pathways | |||||
MAPK signaling pathway | |||||
Ras signaling pathway | |||||
Vascular smooth muscle contraction | |||||
VEGF signaling pathway | |||||
Platelet activation | |||||
Fc epsilon RI signaling pathway | |||||
Fc gamma R-mediated phagocytosis | |||||
Glutamatergic synapse | |||||
Serotonergic synapse | |||||
Long-term depression | |||||
Inflammatory mediator regulation of TRP channels | |||||
GnRH signaling pathway | |||||
Ovarian steroidogenesis | |||||
Oxytocin signaling pathway | |||||
Choline metabolism in cancer | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
PANTHER Pathway | Angiogenesis | ||||
Endothelin signaling pathway | |||||
Inflammation mediated by chemokine and cytokine signaling pathway | |||||
Oxidative stress response | |||||
VEGF signaling pathway | |||||
CCKR signaling map ST | |||||
Pathway Interaction Database | Fc-epsilon receptor I signaling in mast cells | ||||
Endothelins | |||||
PDGFR-beta signaling pathway | |||||
Signaling mediated by p38-alpha and p38-beta | |||||
PathWhiz Pathway | Fc Epsilon Receptor I Signaling in Mast Cells | ||||
Reactome | Acyl chain remodelling of PC | ||||
Acyl chain remodelling of PE | |||||
Acyl chain remodelling of PI | |||||
ADP signalling through P2Y purinoceptor 1 | |||||
Platelet sensitization by LDL | |||||
WikiPathways | Prostaglandin Synthesis and Regulation | ||||
p38 MAPK Signaling Pathway | |||||
Glycerophospholipid biosynthesis | |||||
Arachidonic acid metabolism | |||||
PDGF Pathway | |||||
Integrated Pancreatic Cancer Pathway | |||||
AGE/RAGE pathway | |||||
Opioid Signalling | |||||
Signal amplification | |||||
Platelet homeostasis | |||||
References | |||||
Ref 528680 | J Med Chem. 2007 Mar 22;50(6):1380-400. Epub 2007 Feb 17.Discovery of Ecopladib, an indole inhibitor of cytosolic phospholipase A2alpha. | ||||
Ref 529028 | Bioorg Med Chem. 2007 Nov 15;15(22):7138-43. Epub 2007 Aug 22.Inhibitory effect of synthetic C-C biflavones on various phospholipase A(2)s activity. | ||||
Ref 529795 | Bioorg Med Chem. 2008 Dec 15;16(24):10257-69. Epub 2008 Nov 1.Structure-activity relationships of natural and non-natural amino acid-based amide and 2-oxoamide inhibitors of human phospholipase A(2)enzymes. | ||||
Ref 529843 | J Med Chem. 2008 Dec 25;51(24):8027-37.Synthesis of polyfluoro ketones for selective inhibition of human phospholipase A2 enzymes. | ||||
Ref 529940 | J Med Chem. 2009 Feb 26;52(4):1156-71.Reactions of functionalized sulfonamides: application to lowering the lipophilicity of cytosolic phospholipase A2alpha inhibitors. | ||||
Ref 530139 | Bioorg Med Chem. 2009 Jul 1;17(13):4833-43. Epub 2009 May 3.2-Oxoamide inhibitors of phospholipase A2 activity and cellular arachidonate release based on dipeptides and pseudodipeptides. | ||||
Ref 530576 | Bioorg Med Chem. 2010 Jan 15;18(2):945-52. Epub 2009 Nov 17.1-Indol-1-yl-propan-2-ones and related heterocyclic compounds as dual inhibitors of cytosolic phospholipase A(2)alpha and fatty acid amidehydrolase. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.