Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T00663
|
||||
| Former ID |
TTDR00928
|
||||
| Target Name |
Mitogen-activated protein kinase 10
|
||||
| Gene Name |
MAPK10
|
||||
| Synonyms |
C-Jun N-terminal kinase 3; JNK3; MAP kinase p49 3F12; Stress-activated protein kinase JNK3; MAPK10
|
||||
| Target Type |
Research
|
||||
| Disease | Central nervous system injury [ICD10: P11.9] | ||||
| Function |
Serine/threonine-protein kinase involved in various processes such as neuronal proliferation, differentiation, migration and programmed cell death. Extracellular stimuli such as proinflammatory cytokines or physical stress stimulate the stress- activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK10/JNK3. In turn, MAPK10/JNK3 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN and ATF2 and thus regulates AP-1 transcriptional activity. Plays regulatory roles in the signaling pathways during neuronal apoptosis. Phosphorylates the neuronal microtubule regulator STMN2. Acts in the regulation of the beta-amyloid precursor protein/APP signaling during neuronal differentiation by phosphorylating APP. Participates also in neurite growth in spiral ganglion neurons. Phosphorylates the CLOCK-ARNTL/BMAL1 heterodimer and plays a role in the photic regulation of the circadian clock (PubMed:22441692).
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T00663
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.11.24
|
||||
| Sequence |
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR |
||||
| Structure |
1JNK; 1PMN; 1PMQ; 1PMU; 1PMV; 2B1P; 2EXC; 2O0U; 2O2U; 2OK1; 2P33; 2R9S; 2WAJ; 2ZDT; 2ZDU; 3CGF; 3CGO; 3DA6; 3FI2; 3FI3; 3FV8; 3G90; 3G9L; 3G9N; 3KVX; 3OXI; 3OY1; 3PTG; 3RTP; 3TTI; 3TTJ; 3V6R; 3V6S; 4H36; 4H39; 4H3B; 4KKE; 4KKG; 4KKH; 4U79; 4WHZ
|
||||
| Inhibitor | 2,6-Dihydroanthra/1,9-Cd/Pyrazol-6-One | Drug Info | [551393] | ||
| 9-(4-Hydroxyphenyl)-2,7-Phenanthroline | Drug Info | [551393] | |||
| AC1LG8KT | Drug Info | [543430] | |||
| aminopyridine deriv. 2 | Drug Info | [528237] | |||
| AS-601245 | Drug Info | [529213] | |||
| ELN-864709 | Drug Info | [543430] | |||
| JNK-IN-8 | Drug Info | [531775] | |||
| N-(4-amino-5-cyano-6-ethoxypyridin-2-yl)acetamide | Drug Info | [528237] | |||
| N-(4-amino-5-cyano-6-phenylpyridin-2-yl)acetamide | Drug Info | [528237] | |||
| NSC-656158 | Drug Info | [530662] | |||
| Phenyl-(3-phenyl-1H-indazol-6-yl)-amine | Drug Info | [527722] | |||
| Phosphoaminophosphonic Acid-Adenylate Ester | Drug Info | [551374] | |||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| ErbB signaling pathway | |||||
| Ras signaling pathway | |||||
| cAMP signaling pathway | |||||
| FoxO signaling pathway | |||||
| Sphingolipid signaling pathway | |||||
| Protein processing in endoplasmic reticulum | |||||
| Wnt signaling pathway | |||||
| Osteoclast differentiation | |||||
| Focal adhesion | |||||
| Toll-like receptor signaling pathway | |||||
| NOD-like receptor signaling pathway | |||||
| RIG-I-like receptor signaling pathway | |||||
| Fc epsilon RI signaling pathway | |||||
| TNF signaling pathway | |||||
| Neurotrophin signaling pathway | |||||
| Retrograde endocannabinoid signaling | |||||
| Dopaminergic synapse | |||||
| Inflammatory mediator regulation of TRP channels | |||||
| Insulin signaling pathway | |||||
| GnRH signaling pathway | |||||
| Progesterone-mediated oocyte maturation | |||||
| Prolactin signaling pathway | |||||
| Adipocytokine signaling pathway | |||||
| Type II diabetes mellitus | |||||
| Non-alcoholic fatty liver disease (NAFLD) | |||||
| Epithelial cell signaling in Helicobacter pylori infection | |||||
| Shigellosis | |||||
| Salmonella infection | |||||
| Pertussis | |||||
| Chagas disease (American trypanosomiasis) | |||||
| Toxoplasmosis | |||||
| Tuberculosis | |||||
| Hepatitis C | |||||
| Hepatitis B | |||||
| Influenza A | |||||
| Herpes simplex infection | |||||
| Epstein-Barr virus infection | |||||
| Pathways in cancer | |||||
| Colorectal cancer | |||||
| Pancreatic cancer | |||||
| Choline metabolism in cancer | |||||
| PANTHER Pathway | Alzheimer disease-amyloid secretase pathway | ||||
| Apoptosis signaling pathway | |||||
| B cell activation | |||||
| EGF receptor signaling pathway | |||||
| FAS signaling pathway | |||||
| FGF signaling pathway | |||||
| Integrin signalling pathway | |||||
| Interferon-gamma signaling pathway | |||||
| Parkinson disease | |||||
| TGF-beta signaling pathway | |||||
| Ras Pathway | |||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | Noncanonical Wnt signaling pathway | ||||
| CD40/CD40L signaling | |||||
| FAS (CD95) signaling pathway | |||||
| Glucocorticoid receptor regulatory network | |||||
| FoxO family signaling | |||||
| p75(NTR)-mediated signaling | |||||
| ErbB2/ErbB3 signaling events | |||||
| PDGFR-beta signaling pathway | |||||
| Nephrin/Neph1 signaling in the kidney podocyte | |||||
| Reactome | Oxidative Stress Induced Senescence | ||||
| FCERI mediated MAPK activation | |||||
| JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 | |||||
| Activation of the AP-1 family of transcription factors | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| DNA Damage Response (only ATM dependent) | |||||
| G13 Signaling Pathway | |||||
| Insulin Signaling | |||||
| Wnt Signaling Pathway | |||||
| MAPK Cascade | |||||
| Oxidative Stress | |||||
| Wnt Signaling Pathway and Pluripotency | |||||
| Apoptosis Modulation by HSP70 | |||||
| MAPK Signaling Pathway | |||||
| Nanoparticle-mediated activation of receptor signaling | |||||
| Structural Pathway of Interleukin 1 (IL-1) | |||||
| Apoptosis | |||||
| BDNF signaling pathway | |||||
| Integrin-mediated Cell Adhesion | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| References | |||||
| Ref 527722 | Bioorg Med Chem Lett. 2005 Nov 15;15(22):5095-9.Design and synthesis of 6-anilinoindazoles as selective inhibitors of c-Jun N-terminal kinase-3. | ||||
| Ref 528237 | J Med Chem. 2006 Jun 15;49(12):3563-80.Aminopyridine-based c-Jun N-terminal kinase inhibitors with cellular activity and minimal cross-kinase activity. | ||||
| Ref 529213 | Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20523-8. Epub 2007 Dec 11.A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases. | ||||
| Ref 530662 | J Med Chem. 2010 Feb 25;53(4):1616-26.Synthesis and preclinical evaluations of 2-(2-fluorophenyl)-6,7-methylenedioxyquinolin-4-one monosodium phosphate (CHM-1-P-Na) as a potent antitumor agent. | ||||
| Ref 531775 | Discovery of potent and selective covalent inhibitors of JNK. Chem Biol. 2012 Jan 27;19(1):140-54. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

