Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T02532
|
||||
Former ID |
TTDS00368
|
||||
Target Name |
T-cell surface antigen CD2
|
||||
Gene Name |
CD2
|
||||
Synonyms |
Erythrocyte receptor; LFA-2; LFA-3 receptor; Rosette receptor; T-cell surface antigen T11/Leu-5; CD2
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Cancer; Psoriasis [ICD9: 140-229, 696; ICD10: L40] | ||||
Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
Function |
CD2 interacts with lymphocyte function-associated antigen (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T- cells, the cytoplasmic domain is implicated in the signaling function.
|
||||
BioChemical Class |
Transmembrane protein
|
||||
UniProt ID | |||||
Sequence |
MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE
KTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEK IFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN |
||||
Drugs and Mode of Action | |||||
Pathways | |||||
KEGG Pathway | Cell adhesion molecules (CAMs) | ||||
Hematopoietic cell lineage | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
IL2 Signaling Pathway | |||||
Reactome | Cell surface interactions at the vascular wall | ||||
WikiPathways | Cell surface interactions at the vascular wall | ||||
References | |||||
Ref 527770 | J Med Chem. 2005 Oct 6;48(20):6236-49.Structure-activity studies of peptides from the "hot-spot" region of human CD2 protein: development of peptides for immunomodulation. | ||||
Ref 529900 | J Med Chem. 2009 Feb 12;52(3):726-36.Design of beta-hairpin peptides for modulation of cell adhesion by beta-turn constraint. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.