Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T02703
|
||||
| Former ID |
TTDS00337
|
||||
| Target Name |
Nitric oxide synthase, inducible
|
||||
| Gene Name |
NOS2
|
||||
| Synonyms |
HEP-NOS; Hepatocyte NOS; INOS; Inducible NOS; Inducible nitric oxide synthase; NOS, type II; NOS2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Asthma [ICD10: J45] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Coronary artery disease [ICD9: 410-414, 429.2; ICD10: I20-I25] | |||||
| Diabetic kidney disease [ICD10: E11.22] | |||||
| Endotoxic shock [ICD10: R57.8] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Osteoarthritis [ICD9: 715; ICD10: M15-M19, M47] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Restenosis [ICD10: I51.89] | |||||
| Septic shock [ICD9: 785.52; ICD10: A41.9] | |||||
| Function |
Produces nitric oxide (no) which is a messenger molecule with diverse functions throughout the body. In macrophages, no mediates tumoricidal and bactericidal actions.
|
||||
| BioChemical Class |
Oxidoreductases acting on paired donors
|
||||
| Target Validation |
T02703
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.14.13.39
|
||||
| Sequence |
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR VAVQPSSLEMSAL |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Curcumin | Drug Info | Phase 3 | Cancer | [532348], [542031] |
| MPL-S | Drug Info | Phase 3 | Endotoxic shock | [522351] | |
| SD-6010 | Drug Info | Phase 3 | Osteoarthritis | [523634] | |
| Pimagedine HCl | Drug Info | Phase 2/3 | Diabetic kidney disease | [546189] | |
| GW274150 | Drug Info | Phase 2 | Asthma | [521884] | |
| KD-7040 | Drug Info | Phase 2 | Pain | [522187] | |
| LT-1951 | Drug Info | Phase 1/2 | Coronary artery disease | [521773] | |
| Aminoguanidine | Drug Info | Phase 1 | Discovery agent | [468198], [521693] | |
| NOStentin | Drug Info | Discontinued in Phase 1 | Restenosis | [547127] | |
| ONO-1714 | Drug Info | Discontinued in Phase 1 | Septic shock | [547187] | |
| L-NIL | Drug Info | Terminated | Discovery agent | [546719] | |
| Inhibitor | ((E)-7-But-2-enyl)-azepan-(2Z)-ylideneamine | Drug Info | [526140] | ||
| (4S,5R)-4,5-Diethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [526912] | |||
| (4S,5R)-4,5-Dimethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [526912] | |||
| (4S,5R)-4,5-Dipropyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [526912] | |||
| (4S,5S)-4,5-Diethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [526912] | |||
| (4S,5S)-4,5-Dipropyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [526912] | |||
| (5-Imino-[1,4]thiazepan-3-yl)-methanol | Drug Info | [527266] | |||
| (5S,6R)-[Octahydro-quinolin-(2E)-ylidene]amine | Drug Info | [527502] | |||
| (5S,6S)-[Octahydro-quinolin-(2E)-ylidene]amine | Drug Info | [527502] | |||
| (6r,1'r,2's)-5,6,7,8 Tetrahydrobiopterin | Drug Info | [551393] | |||
| (E)-4-Methyl-6-(prop-1-enyl)pyridin-2-amine | Drug Info | [530039] | |||
| (R)-3-Propyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [527266] | |||
| (S)-2-Amino-5-(N-methyl-guanidino)-pentanoic acid | Drug Info | [534097] | |||
| (S)-2-Amino-6-[(E)-ethylimino]-hexanoic acid | Drug Info | [534097] | |||
| (S)-3-Propyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [527266] | |||
| (S)-6-Amino-2-(2-imino-ethylamino)-hexanoic acid | Drug Info | [527266] | |||
| (S)-N-(1-phenylethyl)acetimidamide hydrobromide | Drug Info | [531201] | |||
| 1-(6-Amino-4-methylpyridin-2-yl)propan-2-ol | Drug Info | [530039] | |||
| 1400W | Drug Info | [534325] | |||
| 2-(2-Amino-ethyl)-7-imino-azepane | Drug Info | [526140] | |||
| 2-amino-4-methylpyridine | Drug Info | [534283] | |||
| 2-Amino-5-(N-nitro-guanidino)-pentanoic acid | Drug Info | [534097] | |||
| 2-Methyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [527266] | |||
| 3,4-Dihydro-1H-quinolin-(2E)-ylideneamine | Drug Info | [527502] | |||
| 3,4-Dimethyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 3-(2-Amino-ethyl)-5-imino-[1,4]oxazepane | Drug Info | [526140] | |||
| 3-(2-Nitro-ethyl)-[1,4]oxazepan-(5Z)-ylideneamine | Drug Info | [526140] | |||
| 3-Bromo-1H-indazole-7-carbonitrile | Drug Info | [529494] | |||
| 3-bromo-7-nitro-1H-indazole | Drug Info | [530315] | |||
| 3-Bromo-7-Nitroindazole | Drug Info | [551393] | |||
| 3-Butyl-[1,4]oxazepan-(5Z)-ylideneamine | Drug Info | [526140] | |||
| 3-Butyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [527266] | |||
| 3-Ethyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [527266] | |||
| 3-Isobutyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [527266] | |||
| 3-Methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 3-Methyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [527266] | |||
| 3-Propyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [527266] | |||
| 4,5,6,7-tetrafluoro-3-methyl-1H-indazole | Drug Info | [530315] | |||
| 4,5,6,7-tetrafluoro-3-perfluorophenyl-1H-indazole | Drug Info | [530315] | |||
| 4,5-Dimethyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 4-(1H-IMIDAZOL-1-YL)PHENOL | Drug Info | [551374] | |||
| 4-Butyl-thiazolidin-(2E)-ylideneamine | Drug Info | [527210] | |||
| 4-Ethyl-3-methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 4-Ethyl-5-methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 4-Ethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [526912] | |||
| 4-Ethyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 4-Isopropyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 4-Methyl-5-propyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 4-Methyl-6-(2-methylprop-1-enyl)pyridin-2-amine | Drug Info | [530039] | |||
| 4-methyl-6-propylpyridin-2-amine | Drug Info | [529745] | |||
| 4-Methyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [526912] | |||
| 4-Methyl-piperidin-(2E)-ylideneamine | Drug Info | [527502] | |||
| 4-Methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 4-methylpyridin-2-amine | Drug Info | [529745] | |||
| 4-[(2-Methyl-1H-imidazol-1-yl)methyl]pyridine | Drug Info | [531201] | |||
| 4r-Fluoro-N6-Ethanimidoyl-L-Lysine | Drug Info | [551393] | |||
| 5-Bromomethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [526912] | |||
| 5-Ethyl-4-methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 5-Ethyl-4-propyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 5-Ethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [526912] | |||
| 5-Methyl-4-propyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 5-Methyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [526912] | |||
| 5-Methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| 5-Nitroindazole | Drug Info | [551393] | |||
| 6-(2-Fluoropropyl)-4-methylpyridin-2-amine | Drug Info | [530039] | |||
| 6-(3-Fluoropropyl)-4-methylpyridin-2-amine | Drug Info | [530039] | |||
| 6-(4-Fluorobutyl)-4-methylpyridin-2-amine | Drug Info | [530039] | |||
| 6-isobutyl-4-methylpyridin-2-amine | Drug Info | [530039] | |||
| 6-methyl-5,6-dihydro-4H-1,3-thiazin-2-amine | Drug Info | [529827] | |||
| 6-Nitroindazole | Drug Info | [551393] | |||
| 7,8-Dihydro-L-Biopterin | Drug Info | [551391] | |||
| 7,8-dihydrobiopterin | Drug Info | [551393] | |||
| 7-(2-Nitro-ethyl)-azepan-(2Z)-ylideneamine | Drug Info | [526140] | |||
| 7-Butyl-azepan-(2Z)-ylideneamine | Drug Info | [526140] | |||
| 7-Methyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [527266] | |||
| 7-nitro-1H-indazole | Drug Info | [530315] | |||
| 7-Nitroindazole | Drug Info | [551393] | |||
| Aminoguanidine | Drug Info | [537573] | |||
| AMINOTHIAZOLINE | Drug Info | [529755] | |||
| AR-C102222 | Drug Info | [529745] | |||
| AR-C133057XX | Drug Info | [529745] | |||
| Azepan-(2Z)-ylideneamine | Drug Info | [526140] | |||
| Azocan-(2Z)-ylideneamine | Drug Info | [526140] | |||
| Azonan-(2Z)-ylideneamine | Drug Info | [534097] | |||
| B-Octylglucoside | Drug Info | [551393] | |||
| BYK-191023 | Drug Info | [543390] | |||
| CDDO | Drug Info | [527517] | |||
| Curcumin | Drug Info | [529213] | |||
| Ethylisothiourea | Drug Info | [551393] | |||
| Heme | Drug Info | [551374] | |||
| Hexahydro-cyclopenta[c]pyrrol-(1Z)-ylideneamine | Drug Info | [527210] | |||
| KD-7040 | Drug Info | [550174] | |||
| KD-7332 | Drug Info | [543390] | |||
| L-NIL | Drug Info | [529159] | |||
| L-NIO | Drug Info | [529811] | |||
| L-Nw-nitroarginine | Drug Info | [531224] | |||
| L-Thiocitrulline | Drug Info | [551393] | |||
| N,N-dimethylarginine | Drug Info | [551405] | |||
| N-(3-(aminomethyl)-benzyl)acetamidine | Drug Info | [531201] | |||
| N-(3-(Aminomethyl)Benzyl)Acetamidine | Drug Info | [551374] | |||
| N-(5-Amino-6-oxo-heptyl)-acetamidine | Drug Info | [527210] | |||
| N-benzylacetimidamide hydrobromide | Drug Info | [531201] | |||
| N-omega-allyl-L-arginine | Drug Info | [529811] | |||
| N-Omega-Hydroxy-L-Arginine | Drug Info | [551393] | |||
| N-omega-propargyl-L-arginine | Drug Info | [529811] | |||
| N-Omega-Propyl-L-Arginine | Drug Info | [551393] | |||
| N5-(1-iminobut-3-enyl)-L-ornithine | Drug Info | [529811] | |||
| N5-(1-iminobutyl)-L-ornithine | Drug Info | [529811] | |||
| N5-(1-iminopropyl)-L-ornithine | Drug Info | [529811] | |||
| Octahydro-isoindol-(1Z)-ylideneamine | Drug Info | [527210] | |||
| Oxazolidin-(2Z)-ylideneamine | Drug Info | [526912] | |||
| PIBTU | Drug Info | [533614] | |||
| Pimagedine HCl | Drug Info | [529604] | |||
| Piperidin-(2E)-ylideneamine | Drug Info | [527502] | |||
| Pyrrolidin-(2Z)-ylideneamine | Drug Info | [527210] | |||
| Resveratrol Potassium4,-Sulfate | Drug Info | [530955] | |||
| S-Ethylisothiourea | Drug Info | [551393] | |||
| SD-6010 | Drug Info | [532114] | |||
| Thiazolidin-(2E)-ylideneamine | Drug Info | [527210] | |||
| THIOCITRULLINE | Drug Info | [527563] | |||
| Thiocoumarin | Drug Info | [551374] | |||
| [1,3]Oxazinan-(2E)-ylideneamine | Drug Info | [534097] | |||
| [1,3]Thiazinan-(2E)-ylideneamine | Drug Info | [534097] | |||
| [1,4]Oxazepan-(3E)-ylideneamine | Drug Info | [527266] | |||
| [1,4]Oxazepan-(5E)-ylideneamine | Drug Info | [527266] | |||
| [1,4]Thiazepan-(3E)-ylideneamine | Drug Info | [527266] | |||
| [1,4]Thiazepan-(5E)-ylideneamine | Drug Info | [527266] | |||
| [1,5]Thiazocan-(4E)-ylideneamine | Drug Info | [526140] | |||
| Modulator | GW274150 | Drug Info | [527488] | ||
| LT-1951 | Drug Info | [526624] | |||
| MPL-S | Drug Info | [534435] | |||
| NOStentin | Drug Info | [527754] | |||
| ONO-1714 | Drug Info | ||||
| SKLB-010 | Drug Info | [543390] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | Citrulline-nitric oxide cycle | ||||
| KEGG Pathway | Arginine biosynthesis | ||||
| Arginine and proline metabolism | |||||
| Metabolic pathways | |||||
| Calcium signaling pathway | |||||
| HIF-1 signaling pathway | |||||
| Peroxisome | |||||
| Salmonella infection | |||||
| Pertussis | |||||
| Leishmaniasis | |||||
| Chagas disease (American trypanosomiasis) | |||||
| Toxoplasmosis | |||||
| Amoebiasis | |||||
| Tuberculosis | |||||
| Pathways in cancer | |||||
| Small cell lung cancer | |||||
| NetPath Pathway | IL1 Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| Pathway Interaction Database | IL12-mediated signaling events | ||||
| Alpha9 beta1 integrin signaling events | |||||
| ATF-2 transcription factor network | |||||
| IL23-mediated signaling events | |||||
| Signaling mediated by p38-alpha and p38-beta | |||||
| HIF-1-alpha transcription factor network | |||||
| Reactome | ROS production in response to bacteria | ||||
| Nitric oxide stimulates guanylate cyclase | |||||
| WikiPathways | Type II interferon signaling (IFNG) | ||||
| Spinal Cord Injury | |||||
| AGE/RAGE pathway | |||||
| Effects of Nitric Oxide | |||||
| References | |||||
| Ref 468198 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5135). | ||||
| Ref 521693 | ClinicalTrials.gov (NCT00184990) Effect of Selective iNOS Inhibition During Human Endotoxemia. U.S. National Institutes of Health. | ||||
| Ref 521773 | ClinicalTrials.gov (NCT00264706) PolyArginine Treated vEiN grafTs (PATENT). U.S. National Institutes of Health. | ||||
| Ref 521884 | ClinicalTrials.gov (NCT00370435) Study Of 90mg Of GW274150 In Subjects Over 50 Years, Who Have Rheumatoid Arthritis (RA). U.S. National Institutes of Health. | ||||
| Ref 522187 | ClinicalTrials.gov (NCT00576108) A 2 Week Study of Topical KD7040 in the Treatment of Postherpetic Neuralgia (PHN). U.S. National Institutes of Health. | ||||
| Ref 522351 | ClinicalTrials.gov (NCT00699764) Safety of a Herpes Simplex Candidate Vaccine (gD2t) With MPL and Its Efficacy to Prevent Genital Herpes Disease. U.S. National Institutes of Health. | ||||
| Ref 523634 | ClinicalTrials.gov (NCT01438918) X-Ray Study Investigating The Safety And Efficacy Of SD-6010 In Subjects With Osteoarthritis Of The Knee. U.S. National Institutes of Health. | ||||
| Ref 532348 | Nanocurcumin: a promising therapeutic advancement over native curcumin. Crit Rev Ther Drug Carrier Syst. 2013;30(4):331-68. | ||||
| Ref 542031 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7000). | ||||
| Ref 546189 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006816) | ||||
| Ref 546719 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009876) | ||||
| Ref 526140 | Bioorg Med Chem Lett. 2001 Oct 8;11(19):2651-3.Selective heterocyclic amidine inhibitors of human inducible nitric oxide synthase. | ||||
| Ref 526624 | Critical role of L-arginine in endothelial cell survival during oxidative stress. Circulation. 2003 May 27;107(20):2607-14. Epub 2003 May 12. | ||||
| Ref 526912 | Bioorg Med Chem Lett. 2004 Jan 19;14(2):313-6.4,5-Disubstituted-1,3-oxazolidin-2-imine derivatives: a new class of orally bioavailable nitric oxide synthase inhibitor. | ||||
| Ref 527210 | Bioorg Med Chem Lett. 2004 Sep 6;14(17):4539-44.Evaluation of pyrrolidin-2-imines and 1,3-thiazolidin-2-imines as inhibitors of nitric oxide synthase. | ||||
| Ref 527266 | Bioorg Med Chem Lett. 2004 Dec 6;14(23):5907-11.Synthesis of analogs of (1,4)-3- and 5-imino oxazepane, thiazepane, and diazepane as inhibitors of nitric oxide synthases. | ||||
| Ref 527488 | Br J Pharmacol. 2005 Jun;145(3):301-12.GW274150 and GW273629 are potent and highly selective inhibitors of inducible nitric oxide synthase in vitro and in vivo. | ||||
| Ref 527502 | Bioorg Med Chem Lett. 2005 Apr 15;15(8):1997-2001.Bicyclic amidine inhibitors of nitric oxide synthase: discovery of perhydro-iminopyrindine and perhydro-iminoquinoline as potent, orally active inhibitors of inducible nitric oxide synthase. | ||||
| Ref 527517 | Bioorg Med Chem Lett. 2005 May 2;15(9):2215-9.Studies on the reactivity of CDDO, a promising new chemopreventive and chemotherapeutic agent: implications for a molecular mechanism of action. | ||||
| Ref 527563 | Bioorg Med Chem Lett. 2005 Jun 2;15(11):2881-5. Epub 2005 Apr 25.Evaluation of 3-substituted arginine analogs as selective inhibitors of human nitric oxide synthase isozymes. | ||||
| Ref 527754 | Gene therapy with iNOS provides long-term protection against myocardial infarction without adverse functional consequences. Am J Physiol Heart Circ Physiol. 2006 Feb;290(2):H584-9. Epub 2005 Sep 19. | ||||
| Ref 529159 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):336-43. Epub 2007 Oct 25.Discovery of a series of aminopiperidines as novel iNOS inhibitors. | ||||
| Ref 529213 | Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20523-8. Epub 2007 Dec 11.A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases. | ||||
| Ref 529494 | Bioorg Med Chem. 2008 Jun 1;16(11):5962-73. Epub 2008 Apr 26.Inhibitory effects of a series of 7-substituted-indazoles toward nitric oxide synthases: particular potency of 1H-indazole-7-carbonitrile. | ||||
| Ref 529604 | Nitric oxide associated with iNOS expression inhibits acetylcholinesterase activity and induces memory impairment during acute hypobaric hypoxia. Brain Res. 2008 Sep 16;1230:138-49. | ||||
| Ref 529745 | Nat Chem Biol. 2008 Nov;4(11):700-7. Epub 2008 Oct 12.Anchored plasticity opens doors for selective inhibitor design in nitric oxide synthase. | ||||
| Ref 529755 | Bioorg Med Chem Lett. 2008 Dec 1;18(23):6206-9. Epub 2008 Oct 5.The design, synthesis and biological evaluation of 7-alkoxy-4-heteroarylamino-3-cyanoquinolines as dual inhibitors of c-Src and iNOS. | ||||
| Ref 529811 | Bioorg Med Chem. 2008 Dec 15;16(24):10205-9. Epub 2008 Oct 29.Structure-activity relationship of novel and known inhibitors of human dimethylarginine dimethylaminohydrolase-1: alkenyl-amidines as new leads. | ||||
| Ref 529827 | Bioorg Med Chem Lett. 2009 Jan 1;19(1):74-6. Epub 2008 Nov 12.Synthesis of biflavones having a 6-O-7'' linkage and effects on cyclooxygenase-2 and inducible nitric oxide synthase. | ||||
| Ref 530039 | J Med Chem. 2009 Apr 23;52(8):2443-53.Design and synthesis of 2-amino-4-methylpyridine analogues as inhibitors for inducible nitric oxide synthase and in vivo evaluation of [18F]6-(2-fluoropropyl)-4-methyl-pyridin-2-amine as a potential PET tracer for inducible nitric oxide synthase. | ||||
| Ref 530315 | Bioorg Med Chem. 2009 Sep 1;17(17):6180-7. Epub 2009 Aug 6.Fluorinated indazoles as novel selective inhibitors of nitric oxide synthase (NOS): synthesis and biological evaluation. | ||||
| Ref 530955 | J Med Chem. 2010 Jul 8;53(13):5033-43.Selective synthesis and biological evaluation of sulfate-conjugated resveratrol metabolites. | ||||
| Ref 531201 | Bioorg Med Chem Lett. 2010 Nov 15;20(22):6495-9. Epub 2010 Sep 17.N-Substituted acetamidines and 2-methylimidazole derivatives as selective inhibitors of neuronal nitric oxide synthase. | ||||
| Ref 531224 | J Med Chem. 2010 Nov 11;53(21):7804-24.Exploration of the active site of neuronal nitric oxide synthase by the design and synthesis of pyrrolidinomethyl 2-aminopyridine derivatives. | ||||
| Ref 532114 | A 2-year randomised, double-blind, placebo-controlled, multicentre study of oral selective iNOS inhibitor, cindunistat (SD-6010), in patients with symptomatic osteoarthritis of the knee. Ann Rheum Dis. 2013 Feb;72(2):187-95. | ||||
| Ref 533614 | Potent and selective inhibition of human nitric oxide synthases. Inhibition by non-amino acid isothioureas. J Biol Chem. 1994 Oct 28;269(43):26669-76. | ||||
| Ref 534097 | J Med Chem. 1996 Feb 2;39(3):669-72.2-Iminopiperidine and other 2-iminoazaheterocycles as potent inhibitors of human nitric oxide synthase isoforms. | ||||
| Ref 534283 | Br J Pharmacol. 1996 Nov;119(6):1101-8.2-Amino-4-methylpyridine as a potent inhibitor of inducible NO synthase activity in vitro and in vivo. | ||||
| Ref 534325 | 1400W is a slow, tight binding, and highly selective inhibitor of inducible nitric-oxide synthase in vitro and in vivo. J Biol Chem. 1997 Feb 21;272(8):4959-63. | ||||
| Ref 534435 | Lipopolysaccharide and monophosphoryl lipid A differentially regulate interleukin-12, gamma interferon, and interleukin-10 mRNA production in murine macrophages. Infect Immun. 1997 Aug;65(8):3239-47. | ||||
| Ref 537573 | Inhibitory effects of aminoguanidine on thyroid follicular carcinoma development in inflamed capsular regions of rats treated with sulfadimethoxine after N-bis(2-hydroxypropyl)nitrosamine-initiation.Cancer Sci. 2009 Jul 1. | ||||
| Ref 543390 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1250). | ||||
| Ref 550174 | WO patent application no. 2014,0214,08, Method for treating cancer by anticancer agent co-administration. | ||||
| Ref 551391 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

