Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T11241
|
||||
Former ID |
TTDI02523
|
||||
Target Name |
Sphingosine-1-phosphate receptor-3
|
||||
Gene Name |
S1PR3
|
||||
Synonyms |
Endothelial differentiation G-protein coupled receptor 3; S1P receptor 3; S1P receptor Edg-3; S1P3; Sphingosine 1-phosphate receptor Edg-3; S1PR3
|
||||
Target Type |
Research
|
||||
Disease | Breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
Function |
Receptor for the lysosphingolipid sphingosine 1- phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. When expressed in rat HTC4 hepatoma cells, is capable of mediating S1P-induced cell proliferation and suppression of apoptosis.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
UniProt ID | |||||
Sequence |
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP SSCIMDKNAALQNGIFCN |
||||
Pathways | |||||
KEGG Pathway | Sphingolipid signaling pathway | ||||
Neuroactive ligand-receptor interaction | |||||
Pathway Interaction Database | S1P3 pathway | ||||
Sphingosine 1-phosphate (S1P) pathway | |||||
Reactome | G alpha (i) signalling events | ||||
Lysosphingolipid and LPA receptors | |||||
WikiPathways | Signal Transduction of S1P Receptor | ||||
Small Ligand GPCRs | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 526319 | The immune modulator FTY720 targets sphingosine 1-phosphate receptors. J Biol Chem. 2002 Jun 14;277(24):21453-7. Epub 2002 Apr 19. | ||||
Ref 526947 | Immune cell regulation and cardiovascular effects of sphingosine 1-phosphate receptor agonists in rodents are mediated via distinct receptor subtypes. J Pharmacol Exp Ther. 2004 May;309(2):758-68. Epub 2004 Jan 27. | ||||
Ref 527334 | Sphingosine 1-phosphate analogs as receptor antagonists. J Biol Chem. 2005 Mar 18;280(11):9833-41. Epub 2004 Dec 8. | ||||
Ref 527767 | Discovery of potent 3,5-diphenyl-1,2,4-oxadiazole sphingosine-1-phosphate-1 (S1P1) receptor agonists with exceptional selectivity against S1P2 and S1P3. J Med Chem. 2005 Oct 6;48(20):6169-73. | ||||
Ref 528528 | Synthesis and biological evaluation of gamma-aminophosphonates as potent, subtype-selective sphingosine 1-phosphate receptor agonists and antagonists. Bioorg Med Chem. 2007 Jan 15;15(2):663-77. Epub2006 Nov 1. | ||||
Ref 528529 | A monoselective sphingosine-1-phosphate receptor-1 agonist prevents allograft rejection in a stringent rat heart transplantation model. Chem Biol. 2006 Nov;13(11):1227-34. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.