Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T11253
|
||||
| Former ID |
TTDC00269
|
||||
| Target Name |
mRNA of Heatshock 27 kDa protein
|
||||
| Gene Name |
HSPB1
|
||||
| Synonyms |
28 kDa heat shock protein; Estrogen-regulated 24 kDa protein; HSP 27; Heat shock protein 27; HspB1; SRP27; Stress-responsive protein 27; HSPB1
|
||||
| Target Type |
Discontinued
|
||||
| Disease | Arthritis [ICD9: 710-719; ICD10: M00-M25] | ||||
| Breast cancer; Ovarian cancer; Bladder cancer; Prostate cancer; Lung cancer [ICD9: 140-229, 162, 183, 188; ICD10: C00-C96, C33-C34, C56, C67] | |||||
| Function |
Involved in stress resistance and actin organization.
|
||||
| BioChemical Class |
Heat shock protein
|
||||
| Target Validation |
T11253
|
||||
| UniProt ID | |||||
| Sequence |
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT IPVTFESRAQLGGPEAAKSDETAAK |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| VEGF signaling pathway | |||||
| Amoebiasis | |||||
| Epstein-Barr virus infection | |||||
| NetPath Pathway | EGFR1 Signaling Pathway | ||||
| PANTHER Pathway | Angiogenesis | ||||
| VEGF signaling pathway | |||||
| p38 MAPK pathway | |||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | p38 signaling mediated by MAPKAP kinases | ||||
| Signaling mediated by p38-alpha and p38-beta | |||||
| Reactome | VEGFA-VEGFR2 Pathway | ||||
| MAPK6/MAPK4 signaling | |||||
| WikiPathways | p38 MAPK Signaling Pathway | ||||
| MAPK Signaling Pathway | |||||
| FAS pathway and Stress induction of HSP regulation | |||||
| Apoptosis-related network due to altered Notch3 in ovarian cancer | |||||
| Regulation of mRNA Stability by Proteins that Bind AU-rich Elements | |||||
| References | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

