Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T11309
|
||||
Former ID |
TTDR00451
|
||||
Target Name |
C-C motif chemokine 2
|
||||
Gene Name |
CCL2
|
||||
Synonyms |
HC11; MCAF; MCP-1; MCP1; Monocyte Chemoattractant Protein 1; Monocyte chemoattractant protein-1; Monocyte chemotactic and activating factor; Monocyte chemotactic protein 1; Monocyte secretory protein JE; SCYA2; Small-inducible cytokine A2; CCL2
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Asthma [ICD10: J45] | ||||
Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
Diabetic complication [ICD10: E08-E13] | |||||
Nephritis [ICD10: N00-N19, N25-N29] | |||||
Pulmonary fibrosis [ICD9: 515, 516.3; ICD10: J84.1] | |||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Function |
Chemotactic factor that attracts monocytes and basophils but not neutrophils or eosinophils. Augments monocyte anti-tumor activity. Has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis or atherosclerosis. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis.
|
||||
BioChemical Class |
Cytokine: CC chemokine
|
||||
Target Validation |
T11309
|
||||
UniProt ID | |||||
Sequence |
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT |
||||
Drugs and Mode of Action | |||||
Drug(s) | Bindarit | Drug Info | Phase 3 | Nephritis | [531744] |
Carlumab | Drug Info | Phase 2 | Pulmonary fibrosis | [532844], [542685] | |
NOX-E36 | Drug Info | Phase 2 | Diabetic complication | [523824] | |
MCP-1 | Drug Info | Preclinical | Rheumatoid arthritis | [536223] | |
RS-504393 | Drug Info | Preclinical | Chronic obstructive pulmonary disease | [536223], [542757] | |
ABN-912 | Drug Info | Discontinued in Phase 1 | Asthma | [547919] | |
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
Chemokine signaling pathway | |||||
NOD-like receptor signaling pathway | |||||
TNF signaling pathway | |||||
Chagas disease (American trypanosomiasis) | |||||
Malaria | |||||
Influenza A | |||||
Herpes simplex infection | |||||
Rheumatoid arthritis | |||||
NetPath Pathway | IL9 Signaling Pathway | ||||
IL5 Signaling Pathway | |||||
IL1 Signaling Pathway | |||||
TSH Signaling Pathway | |||||
TWEAK Signaling Pathway | |||||
IL4 Signaling Pathway | |||||
TNFalpha Signaling Pathway | |||||
TSLP Signaling Pathway | |||||
Leptin Signaling Pathway | |||||
RANKL Signaling Pathway | |||||
PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
Pathway Interaction Database | GMCSF-mediated signaling events | ||||
Validated transcriptional targets of AP1 family members Fra1 and Fra2 | |||||
AP-1 transcription factor network | |||||
IL23-mediated signaling events | |||||
Reactome | Chemokine receptors bind chemokines | ||||
ATF4 activates genes | |||||
WikiPathways | IL1 and megakaryotyces in obesity | ||||
Activation of Genes by ATF4 | |||||
Spinal Cord Injury | |||||
Oncostatin M Signaling Pathway | |||||
TNF alpha Signaling Pathway | |||||
TWEAK Signaling Pathway | |||||
IL-1 signaling pathway | |||||
GPCR ligand binding | |||||
Folate Metabolism | |||||
Vitamin B12 Metabolism | |||||
Selenium Micronutrient Network | |||||
References | |||||
Ref 523824 | ClinicalTrials.gov (NCT01547897) NOX-E36 in Patients With Type 2 Diabetes Mellitus and Albuminuria. U.S. National Institutes of Health. | ||||
Ref 531744 | Bindarit: an anti-inflammatory small molecule that modulates the NF?B pathway. Cell Cycle. 2012 Jan 1;11(1):159-69. | ||||
Ref 532844 | Carlumab, an anti-C-C chemokine ligand 2 monoclonal antibody, in combination with four chemotherapy regimens for the treatment of patients with solid tumors: an open-label, multicenter phase 1b study. Target Oncol. 2015 Mar;10(1):111-23. | ||||
Ref 536223 | Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. | ||||
Ref 542685 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 771). | ||||
Ref 528332 | A randomized controlled trial with an anti-CCL2 (anti-monocyte chemotactic protein 1) monoclonal antibody in patients with rheumatoid arthritis. Arthritis Rheum. 2006 Aug;54(8):2387-92. | ||||
Ref 531744 | Bindarit: an anti-inflammatory small molecule that modulates the NF?B pathway. Cell Cycle. 2012 Jan 1;11(1):159-69. | ||||
Ref 532844 | Carlumab, an anti-C-C chemokine ligand 2 monoclonal antibody, in combination with four chemotherapy regimens for the treatment of patients with solid tumors: an open-label, multicenter phase 1b study. Target Oncol. 2015 Mar;10(1):111-23. | ||||
Ref 533216 | Crystal structure of a mirror-image L-RNA aptamer (Spiegelmer) in complex with the natural L-protein target CCL2. Nat Commun. 2015 Apr 22;6:6923. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.