Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T13409
|
||||
| Former ID |
TTDI02209
|
||||
| Target Name |
HIV p17 matrix protein
|
||||
| Gene Name |
gag
|
||||
| Synonyms |
gag
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | ||||
| Function |
p6-gag: Plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1.
|
||||
| UniProt ID | |||||
| Sequence |
GARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQIL
GQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAAD TGHSNQVSQNY |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| Reactome | Uncoating of the HIV Virion | ||||
| Budding and maturation of HIV virion | |||||
| Integration of provirus | |||||
| Early Phase of HIV Life Cycle | |||||
| Minus-strand DNA synthesis | |||||
| Plus-strand DNA synthesis | |||||
| 2-LTR circle formation | |||||
| Binding and entry of HIV virion | |||||
| Membrane binding and targetting of GAG proteins | |||||
| Assembly Of The HIV Virion | |||||
| Integration of viral DNA into host genomic DNA | |||||
| Autointegration results in viral DNA circles | |||||
| APOBEC3G mediated resistance to HIV-1 infection | |||||
| Vpr-mediated nuclear import of PICs | |||||
| WikiPathways | Host Interactions of HIV factors | ||||
| HIV Life Cycle | |||||
| References | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

