Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T18477
|
||||
| Former ID |
TTDC00018
|
||||
| Target Name |
Heat shock protein HSP 90
|
||||
| Gene Name |
HSP90AA1
|
||||
| Synonyms |
HSP 86; HSP90A; HSPC1; HSPCA; Renal carcinoma antigen NY-REN-38; HSP90AA1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Breast cancer; Melanoma [ICD9: 140-229, 172, 174, 175; ICD10: C00-C96, C43, C50] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Hematological malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Melanoma [ICD9: 172; ICD10: C43] | |||||
| Multiple myeloma [ICD9: 203; ICD10: C90] | |||||
| Ovarian cancer; Refractory hematological malignancies [ICD9: 140-229, 140-239, 183, 200-209; ICD10: C56, C81-C86] | |||||
| Function |
Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes.
|
||||
| BioChemical Class |
Heat shock protein
|
||||
| Target Validation |
T18477
|
||||
| UniProt ID | |||||
| Sequence |
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE GDDDTSRMEEVD |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Tanespimycin | Drug Info | Phase 2 | Breast cancer; Melanoma | [537114], [542715] |
| SNX-5422 | Drug Info | Phase 1/2 | Cancer | [548569] | |
| Alvespimycin hydrochloride | Drug Info | Phase 1 | Ovarian cancer; Refractory hematological malignancies | [521606] | |
| AT13387 | Drug Info | Phase 1 | Melanoma | [550300] | |
| SNX-5422 | Drug Info | Phase 1 | Hematological malignancies | [548569] | |
| Tanespimycin | Drug Info | Discontinued in Phase 3 | Multiple myeloma | [537114], [542715] | |
| Inhibitor | 2-(1H-pyrrol-1-ylcarbonyl)benzene-1,3,5-triol | Drug Info | [551374] | ||
| 2-Methyl-2,4-Pentanediol | Drug Info | [551393] | |||
| 4-(2-methoxyethoxy)-6-methylpyrimidin-2-amine | Drug Info | [551374] | |||
| 6-(3-BROMO-2-NAPHTHYL)-1,3,5-TRIAZINE-2,4-DIAMINE | Drug Info | [551374] | |||
| 8-BENZO[1,3]DIOXOL-,5-YLMETHYL-9-BUTYL-9H- | Drug Info | [551374] | |||
| 9-Butyl-8-(3-Methoxybenzyl)-9h-Purin-6-Amine | Drug Info | [551374] | |||
| 9-Butyl-8-(4-Methoxybenzyl)-9h-Purin-6-Amine | Drug Info | [551374] | |||
| Adenosine-5'-Diphosphate | Drug Info | [551391] | |||
| Alvespimycin hydrochloride | Drug Info | [536622], [536886], [537368] | |||
| AT13387 | Drug Info | [550608] | |||
| Geldanamycin-estradiol hybrid | Drug Info | [525501] | |||
| GNF-PF-67 | Drug Info | [531262] | |||
| RHEIN | Drug Info | [531262] | |||
| SNX-5422 | Drug Info | [536786], [536899] | |||
| Tanespimycin | Drug Info | [536786], [536886], [537107], [537374] | |||
| VER-49009 | Drug Info | [527601] | |||
| ZEARALANONE | Drug Info | [531262] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| Pathways | |||||
| KEGG Pathway | Protein processing in endoplasmic reticulum | ||||
| PI3K-Akt signaling pathway | |||||
| Antigen processing and presentation | |||||
| NOD-like receptor signaling pathway | |||||
| Progesterone-mediated oocyte maturation | |||||
| Estrogen signaling pathway | |||||
| Pathways in cancer | |||||
| Prostate cancer | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| TCR Signaling Pathway | |||||
| Pathway Interaction Database | Signaling events mediated by HDAC Class II | ||||
| Validated targets of C-MYC transcriptional activation | |||||
| Integrin-linked kinase signaling | |||||
| LKB1 signaling events | |||||
| Regulation of Telomerase | |||||
| Glucocorticoid receptor regulatory network | |||||
| Class I PI3K signaling events | |||||
| IL2 signaling events mediated by PI3K | |||||
| Regulation of Androgen receptor activity | |||||
| Integrins in angiogenesis | |||||
| Hypoxic and oxygen homeostasis regulation of HIF-1-alpha | |||||
| ErbB receptor signaling network | |||||
| VEGFR1 specific signals | |||||
| Signaling events mediated by VEGFR1 and VEGFR2 | |||||
| Class I PI3K signaling events mediated by Akt | |||||
| Reactome | Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants | ||||
| Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation | |||||
| Regulation of actin dynamics for phagocytic cup formation | |||||
| eNOS activation | |||||
| Regulation of PLK1 Activity at G2/M Transition | |||||
| Attenuation phase | |||||
| HSF1-dependent transactivation | |||||
| Loss of Nlp from mitotic centrosomes | |||||
| Recruitment of mitotic centrosome proteins and complexes | |||||
| Loss of proteins required for interphase microtubule organization?from the centrosome | |||||
| EPHA-mediated growth cone collapse | |||||
| VEGFA-VEGFR2 Pathway | |||||
| VEGFR2 mediated vascular permeability | |||||
| Anchoring of the basal body to the plasma membrane | |||||
| Constitutive Signaling by EGFRvIII | |||||
| WikiPathways | NRF2 pathway | ||||
| Nuclear Receptors Meta-Pathway | |||||
| Aryl Hydrocarbon Receptor Pathway | |||||
| Binding and Uptake of Ligands by Scavenger Receptors | |||||
| Signaling by ERBB2 | |||||
| Fcgamma receptor (FCGR) dependent phagocytosis | |||||
| Influenza Life Cycle | |||||
| EBV LMP1 signaling | |||||
| Aryl Hydrocarbon Receptor | |||||
| Corticotropin-releasing hormone | |||||
| TNF alpha Signaling Pathway | |||||
| Arylhydrocarbon receptor (AhR) signaling pathway | |||||
| Signaling by EGFR | |||||
| Semaphorin interactions | |||||
| Mitotic G2-G2/M phases | |||||
| Metabolism of nitric oxide | |||||
| NOD pathway | |||||
| References | |||||
| Ref 521606 | ClinicalTrials.gov (NCT00089271) 17-DMAG in Treating Patients With Metastatic or Unresectable Solid Tumors or Lymphomas. U.S. National Institutes of Health. | ||||
| Ref 542715 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7751). | ||||
| Ref 525501 | Bioorg Med Chem Lett. 1999 May 3;9(9):1233-8.Synthesis and evaluation of geldanamycin-estradiol hybrids. | ||||
| Ref 527601 | J Med Chem. 2005 Jun 30;48(13):4212-5.Novel, potent small-molecule inhibitors of the molecular chaperone Hsp90 discovered through structure-based design. | ||||
| Ref 531262 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). | ||||
| Ref 536622 | Stage 1 testing and pharmacodynamic evaluation of the HSP90 inhibitor alvespimycin (17-DMAG, KOS-1022) by the pediatric preclinical testing program. Pediatr Blood Cancer. 2008 Jul;51(1):34-41. | ||||
| Ref 536786 | Targeting Hsp90: small-molecule inhibitors and their clinical development. Curr Opin Pharmacol. 2008 Aug;8(4):370-4. Epub 2008 Jul 31. | ||||
| Ref 536886 | Recent advances in Hsp90 inhibitors as antitumor agents. Anticancer Agents Med Chem. 2008 Oct;8(7):761-82. | ||||
| Ref 536899 | SNX-2112, a selective Hsp90 inhibitor, potently inhibits tumor cell growth, angiogenesis, and osteoclastogenesis in multiple myeloma and other hematologic tumors by abrogating signaling via Akt and ERK. Blood. 2009 Jan 22;113(4):846-55. Epub 2008 Oct 23. | ||||
| Ref 537107 | Acquired resistance to 17-allylamino-17-demethoxygeldanamycin (17-AAG, tanespimycin) in glioblastoma cells. Cancer Res. 2009 Mar 1;69(5):1966-75. Epub 2009 Feb 24. | ||||
| Ref 537368 | Anti-proliferative activity of heat shock protein (Hsp) 90 inhibitors via beta-catenin/TCF7L2 pathway in adult T cell leukemia cells. Cancer Lett. 2009 May 20. | ||||
| Ref 537374 | Tanespimycin: the opportunities and challenges of targeting heat shock protein 90. Expert Opin Investig Drugs. 2009 Jun;18(6):861-8. | ||||
| Ref 550608 | Astex Presents Updates on AT13387, its HSP90 Inhibitor, and AT9283, its Multi-Targeted Kinase Inhibitor at the EORTC-NCI-AACR Cancer Conference. Astex. 2008. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

