Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T20514
|
||||
| Former ID |
TTDS00342
|
||||
| Target Name |
Delta-aminolevulinic acid dehydratase
|
||||
| Gene Name |
ALAD
|
||||
| Synonyms |
ALADH; Delta-aminolevulinate dehydratase; Porphobilinogen synthase; ALAD
|
||||
| Target Type |
Successful
|
||||
| Disease | Photodynamic therapy [ICD9: 706.1; ICD10: L70.0] | ||||
| Function |
Catalyzes an early step in the biosynthesis of tetrapyrroles. Binds two molecules of 5-aminolevulinate per subunit, each at a distinct site, and catalyzes their condensation to form porphobilinogen.
|
||||
| BioChemical Class |
Carbon-oxygen lyases
|
||||
| UniProt ID | |||||
| EC Number |
EC 4.2.1.24
|
||||
| Sequence |
MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKR
LEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACD VCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKE ALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDR DVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAV LEAMTAFRRAGADIIITYYTPQLLQWLKEE |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 3-(2-Aminoethyl)-4-(Aminomethyl)Heptanedioic Acid | Drug Info | [551393] | ||
| 4,7-Dioxosebacic Acid | Drug Info | [551393] | |||
| 4-Oxosebacic Acid | Drug Info | [551393] | |||
| 5-Fluorolevulinic Acid | Drug Info | [551393] | |||
| 5-hydroxyvaleric acid | Drug Info | [551381] | |||
| Aminolevulinic acid | Drug Info | [534911], [535413], [535718] | |||
| Beta-Mercaptoethanol | Drug Info | [551393] | |||
| Delta-Amino Valeric Acid | Drug Info | [551393] | |||
| Formic Acid | Drug Info | [551393] | |||
| Laevulinic Acid | Drug Info | [551393] | |||
| Levulinic Acid | Drug Info | [551393] | |||
| Porphobilinogen | Drug Info | [551393] | |||
| S,S-(2-Hydroxyethyl)Thiocysteine | Drug Info | [551393] | |||
| Pathways | |||||
| BioCyc Pathway | Heme biosynthesis | ||||
| Tetrapyrrole biosynthesis | |||||
| KEGG Pathway | Porphyrin and chlorophyll metabolism | ||||
| Metabolic pathways | |||||
| PANTHER Pathway | Heme biosynthesis | ||||
| PathWhiz Pathway | Porphyrin Metabolism | ||||
| WikiPathways | Heme Biosynthesis | ||||
| Metabolism of porphyrins | |||||
| References | |||||
| Ref 468013 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4784). | ||||
| Ref 534911 | A novel mutation of delta-aminolaevulinate dehydratase in a healthy child with 12% erythrocyte enzyme activity. Br J Haematol. 1999 Sep;106(4):931-7. | ||||
| Ref 535413 | Melatonin protects against delta-aminolevulinic acid-induced oxidative damage in male Syrian hamster Harderian glands. Int J Biochem Cell Biol. 2002 May;34(5):544-53. | ||||
| Ref 535718 | Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

