Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T25005
|
||||
| Former ID |
TTDR00233
|
||||
| Target Name |
Tyrosine-protein kinase BTK
|
||||
| Gene Name |
BTK
|
||||
| Synonyms |
ATK; Agammaglobulinaemia tyrosine kinase; B cell progenitor kinase; BPK; Bruton's tyrosine kinase; BTK
|
||||
| Target Type |
Successful
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| B-cell lymphoma [ICD9: 202.8; ICD10: C85.1] | |||||
| Chronic lymphocytic leukaemia [ICD10: C91] | |||||
| Chronic lymphocytic leukaemia; Refractory or relapsed mantle cell lymphoma [ICD9:200.4; ICD10: C91, C85.7] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Function |
Non-receptor tyrosine kinase indispensable for B lymphocyte development, differentiation and signaling. Binding of antigen to the B-cell antigen receptor (BCR) triggers signaling that ultimately leads to B-cell activation. After BCRengagement and activation at the plasma membrane, phosphorylates PLCG2 at several sites, igniting the downstream signaling pathway through calcium mobilization, followed by activation of the protein kinase C (PKC) family members. PLCG2 phosphorylation is performed in close cooperation with the adapter protein B-cell linker protein BLNK. BTK acts as a platform to bring together a diverse array of signaling proteins and is implicated in cytokine receptor signaling pathways. Plays an important role in the function of immune cells of innate as well as adaptive immunity, as a component of the Toll-like receptors (TLR) pathway. The TLR pathway acts as a primary surveillance system for the detection of pathogens and are crucial to the activation of host defense. Especially, is a critical molecule in regulating TLR9 activation in splenic B-cells. Within the TLR pathway, induces tyrosine phosphorylation of TIRAP which leads to TIRAP degradation. BTK plays also a critical role in transcription regulation. Induces the activity of NF-kappa-B, which is involved in regulating the expression of hundreds of genes. BTK is involved on the signaling pathway linking TLR8 and TLR9 to NF-kappa-B. Transiently phosphorylates transcription factor GTF2I on tyrosine residues in response to BCR. GTF2I then translocates to the nucleus to bind regulatory enhancer elements to modulate gene expression. ARID3A and NFAT are other transcriptional target of BTK. BTK is required for the formation of functional ARID3A DNA-binding complexes. There is however no evidence that BTK itself binds directly to DNA. BTK has a dual role in the regulation of apoptosis.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T25005
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.10.2
|
||||
| Sequence |
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS HRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ibrutinib | Drug Info | Approved | Chronic lymphocytic leukaemia; Refractory or relapsed mantle cell lymphoma | [524263], [541962], [551043] |
| Ibrutinib companion diagnostic | Drug Info | Approved | Chronic lymphocytic leukaemia | [551871] | |
| ACP-196 | Drug Info | Phase 3 | Chronic lymphocytic leukaemia | [525235] | |
| CC-292 | Drug Info | Phase 2 | Chronic lymphocytic leukaemia | [532375] | |
| ACP-319 | Drug Info | Phase 1/2 | Chronic lymphocytic leukaemia | [549565] | |
| ONO-4059 | Drug Info | Phase 1 | B-cell lymphoma | [524010] | |
| PCI-45292 | Drug Info | Preclinical | Autoimmune diabetes | [548870] | |
| GDC-0834 | Drug Info | Terminated | Rheumatoid arthritis | [531450] | |
| Inhibitor | ACP-196 | Drug Info | [550507] | ||
| ACP-319 | Drug Info | [543527] | |||
| CGI-1316 | Drug Info | [543527] | |||
| compound 2c | Drug Info | [532818] | |||
| compound 31 | Drug Info | [532836] | |||
| compound 38 | Drug Info | [532836] | |||
| GDC-0834 | Drug Info | [531450] | |||
| Ibrutinib | Drug Info | [543527] | |||
| Ibrutinib companion diagnostic | Drug Info | [532183] | |||
| Inositol 1,3,4,5-Tetrakisphosphate | Drug Info | [551393] | |||
| LFM-A13 | Drug Info | [529213] | |||
| PCI-45292 | Drug Info | [544344] | |||
| RN486 | Drug Info | [531761] | |||
| Modulator | CC-292 | Drug Info | [532375] | ||
| ONO-4059 | Drug Info | [549764] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| Pathways | |||||
| KEGG Pathway | NF-kappa B signaling pathway | ||||
| Osteoclast differentiation | |||||
| Platelet activation | |||||
| B cell receptor signaling pathway | |||||
| Fc epsilon RI signaling pathway | |||||
| Primary immunodeficiency | |||||
| PANTHER Pathway | B cell activation | ||||
| Pathway Interaction Database | Fc-epsilon receptor I signaling in mast cells | ||||
| BCR signaling pathway | |||||
| FAS (CD95) signaling pathway | |||||
| Class I PI3K signaling events | |||||
| EPO signaling pathway | |||||
| PathWhiz Pathway | Fc Epsilon Receptor I Signaling in Mast Cells | ||||
| Reactome | Mal cascade initiated on plasma membrane | ||||
| Regulation of actin dynamics for phagocytic cup formation | |||||
| DAP12 signaling | |||||
| FCERI mediated Ca+2 mobilization | |||||
| MyD88 deficiency (TLR2/4) | |||||
| IRAK4 deficiency (TLR2/4) | |||||
| RHO GTPases Activate WASPs and WAVEs | |||||
| Antigen activates B Cell Receptor (BCR) leading to generation of second messengers | |||||
| WikiPathways | Kit receptor signaling pathway | ||||
| Mal cascade initiated on plasma membrane | |||||
| Signaling by the B Cell Receptor (BCR) | |||||
| DAP12 interactions | |||||
| B Cell Receptor Signaling Pathway | |||||
| TSLP Signaling Pathway | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| IL-5 Signaling Pathway | |||||
| References | |||||
| Ref 524010 | ClinicalTrials.gov (NCT01659255) Phase I Study of ONO-4059 Given as Monotherapy in Patients With Relapsed/Refractory NHL and CLL. U.S. National Institutes of Health. | ||||
| Ref 524263 | ClinicalTrials.gov (NCT01833039) An Open Label Treatment Use Protocol for Ibrutinib in Subjects With Relapsed or Refractory Mantle Cell Lymphoma. U.S. National Institutes of Health. | ||||
| Ref 525235 | ClinicalTrials.gov (NCT02475681) Study of Obinutuzumab + Chlorambucil, ACP-196 + Obinutuzumab, and ACP-196 in Subjects With Previously Untreated CLL. | ||||
| Ref 531450 | Antiarthritis effect of a novel Bruton's tyrosine kinase (BTK) inhibitor in rat collagen-induced arthritis and mechanism-based pharmacokinetic/pharmacodynamic modeling: relationships between inhibition of BTK phosphorylation and efficacy. J Pharmacol Exp Ther. 2011 Jul;338(1):154-63. | ||||
| Ref 532375 | Inhibition of Btk with CC-292 provides early pharmacodynamic assessment of activity in mice and humans. J Pharmacol Exp Ther. 2013 Aug;346(2):219-28. | ||||
| Ref 541962 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6912). | ||||
| Ref 548870 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029717) | ||||
| Ref 549565 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040955) | ||||
| Ref 529213 | Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20523-8. Epub 2007 Dec 11.A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases. | ||||
| Ref 531450 | Antiarthritis effect of a novel Bruton's tyrosine kinase (BTK) inhibitor in rat collagen-induced arthritis and mechanism-based pharmacokinetic/pharmacodynamic modeling: relationships between inhibition of BTK phosphorylation and efficacy. J Pharmacol Exp Ther. 2011 Jul;338(1):154-63. | ||||
| Ref 531761 | RN486, a selective Bruton's tyrosine kinase inhibitor, abrogates immune hypersensitivity responses and arthritis in rodents. J Pharmacol Exp Ther. 2012 Apr;341(1):90-103. | ||||
| Ref 532183 | Ibrutinib (PCI-32765), the first BTK (Bruton's tyrosine kinase) inhibitor in clinical trials. Curr Hematol Malig Rep. 2013 Mar;8(1):1-6. | ||||
| Ref 532375 | Inhibition of Btk with CC-292 provides early pharmacodynamic assessment of activity in mice and humans. J Pharmacol Exp Ther. 2013 Aug;346(2):219-28. | ||||
| Ref 532818 | Discovery of Disubstituted Imidazo[4,5-b]pyridines and Purines as Potent TrkA Inhibitors. ACS Med Chem Lett. 2012 Jul 26;3(9):705-9. | ||||
| Ref 532836 | Discovery of a series of 2,5-diaminopyrimidine covalent irreversible inhibitors of Bruton's tyrosine kinase with in vivo antitumor activity. J Med Chem. 2014 Jun 26;57(12):5112-28. | ||||
| Ref 543527 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1948). | ||||
| Ref 544344 | Ibrutinib is an irreversible molecular inhibitor of ITK driving a Th1-selective pressure in T lymphocytes. Blood. 2013 October 10; 122(15): 2539-2549. | ||||
| Ref 549764 | ONO-4059, a novel oral Bruton's tyrosine kinase (Btk) inhibitor that demonstrates potent pharmacodynamic activity through Phosphorylated Btk (P-Btk) inhibition, in addition to effective anti-tumour activity in a TMD-8 (DLBCL) xenograft model. Cancer Research. 08/2013; 73(8 Supplement):2452-2452. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

