Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T31309
|
||||
Former ID |
TTDC00319
|
||||
Target Name |
Apoptosis regulator Bcl-2
|
||||
Gene Name |
BCL2
|
||||
Synonyms |
Bcl-2; BCL2
|
||||
Target Type |
Successful
|
||||
Disease | Advanced small cell lung cancer; Relapsed or refractory chronic lymphocytic leukemia; Lymphoid malignancies [ICD9: 140-229, 140-239, 162, 162.9, 202, 204.0, 204.1, 208.9; ICD10: C33-C34, C34.90, C81-C86, C91-C95, C91.0, C91.1] | ||||
Advanced melanoma; Multiple myeloma [ICD9: 172, 203.0; ICD10: C43, C90] | |||||
Amyotrophic lateral sclerosis [ICD9: 335.2; ICD10: G12.2] | |||||
Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
Chronic lymphocytic leukaemia [ICD10: C91] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Prostate cancer [ICD9: 185; ICD10: C61] | |||||
Psoriasis [ICD9: 696; ICD10: L40] | |||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Unspecified [ICD code not available] | |||||
Function |
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).
|
||||
BioChemical Class |
Bcl-2 family
|
||||
Target Validation |
T31309
|
||||
UniProt ID | |||||
Sequence |
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
||||
Drugs and Mode of Action | |||||
Drug(s) | GDC-0199 | Drug Info | Approved | Chronic lymphocytic leukaemia | [889440] |
MCI-186 | Drug Info | Approved | Amyotrophic lateral sclerosis | [889446] | |
Oral paclitaxel | Drug Info | Approved | Cancer | [551871] | |
Taxol | Drug Info | Approved | Breast carcinoma | [530307] | |
GDC-0199 | Drug Info | Phase 3 | Cancer | [524916], [543069] | |
Liposomal encapsulated paclitaxel (LEP) | Drug Info | Phase 3 | Cancer | [551035] | |
Oblimersen | Drug Info | Phase 3 | Advanced melanoma; Multiple myeloma | [521495], [543024] | |
RG7601 | Drug Info | Phase 3 | Chronic lymphocytic leukaemia | [549281] | |
Taxol/Paraplatin/Herceptin | Drug Info | Phase 3 | Breast cancer | [528260] | |
ABT-263 | Drug Info | Phase 2 | Advanced small cell lung cancer; Relapsed or refractory chronic lymphocytic leukemia; Lymphoid malignancies | [543070], [551607] | |
Gossypol | Drug Info | Phase 2 | Prostate cancer | [467538], [522588] | |
Obatoclax | Drug Info | Phase 2 | Solid tumours | [531104] | |
PI-88/Taxotere | Drug Info | Phase 2 | Cancer | [521777] | |
AI-850 | Drug Info | Phase 1 | Solid tumours | [527516], [530307] | |
Irofulven/Taxotere | Drug Info | Phase 1 | Cancer | [551729] | |
Pc4 (topical formulation | Drug Info | Phase 1 | Psoriasis | [526695] | |
ABT-737 | Drug Info | Terminated | Discovery agent | [543071], [546653] | |
Inhibitor | 2,3,4-trihydroxy-5-isopropyl-N-phenyl-benzamide | Drug Info | [528469] | ||
4,5-dibenzylbenzene-1,2-diol | Drug Info | [530890] | |||
5,10-Dioxy-2-phenyl-benzo[g]pteridin-4-ylamine | Drug Info | [526209] | |||
ABT-263 | Drug Info | [536702], [536883], [551607] | |||
ABT-737 | Drug Info | [528642] | |||
Apogossypol | Drug Info | [542839] | |||
N-phenyl-2,3,4-trihydroxy-5-benzyl-benzamide | Drug Info | [528469] | |||
Obatoclax | Drug Info | [531104] | |||
Oblimersen | Drug Info | [537114] | |||
QEDIIRNIARHLAQVGDSMDR | Drug Info | [528469] | |||
TW-37 | Drug Info | [528469] | |||
Modulator | AI-850 | Drug Info | [527516], [530307] | ||
GDC-0199 | Drug Info | [532178] | |||
Irofulven/Taxotere | Drug Info | [526976] | |||
Liposomal encapsulated paclitaxel (LEP) | Drug Info | [526031], [530307] | |||
modified HA14-1 compounds (cancer), GL Pharmaceuticals | Drug Info | [527372] | |||
Oral paclitaxel | Drug Info | [526031], [530307] | |||
PI-88/Taxotere | Drug Info | [530520] | |||
RG7601 | Drug Info | [532178] | |||
Taxol | Drug Info | [530307] | |||
Taxol/Paraplatin/Herceptin | Drug Info | [527947] | |||
WL-276 | Drug Info | [529510] | |||
Regulator | Gossypol | Drug Info | [536135] | ||
Regulator (upregulator) | MCI-186 | Drug Info | [536447] | ||
Agonist | Pc4 (topical formulation | Drug Info | [526695] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | NF-kappa B signaling pathway | ||||
HIF-1 signaling pathway | |||||
Sphingolipid signaling pathway | |||||
Protein processing in endoplasmic reticulum | |||||
PI3K-Akt signaling pathway | |||||
Apoptosis | |||||
Adrenergic signaling in cardiomyocytes | |||||
Focal adhesion | |||||
Neurotrophin signaling pathway | |||||
Cholinergic synapse | |||||
Amyotrophic lateral sclerosis (ALS) | |||||
Toxoplasmosis | |||||
Tuberculosis | |||||
Hepatitis B | |||||
Epstein-Barr virus infection | |||||
Pathways in cancer | |||||
MicroRNAs in cancer | |||||
Colorectal cancer | |||||
Prostate cancer | |||||
Small cell lung cancer | |||||
NetPath Pathway | IL5 Signaling Pathway | ||||
TCR Signaling Pathway | |||||
IL2 Signaling Pathway | |||||
IL3 Signaling Pathway | |||||
Leptin Signaling Pathway | |||||
RANKL Signaling Pathway | |||||
TSLP Signaling Pathway | |||||
PANTHER Pathway | Apoptosis signaling pathway | ||||
Oxidative stress response | |||||
CCKR signaling map ST | |||||
Pathway Interaction Database | Role of Calcineurin-dependent NFAT signaling in lymphocytes | ||||
IL2-mediated signaling events | |||||
IL2 signaling events mediated by PI3K | |||||
Ceramide signaling pathway | |||||
Direct p53 effectors | |||||
RXR and RAR heterodimerization with other nuclear receptor | |||||
ATF-2 transcription factor network | |||||
C-MYB transcription factor network | |||||
Negative effector of Fas and TNF-alpha | |||||
Caspase Cascade in Apoptosis | |||||
Signaling events mediated by Stem cell factor receptor (c-Kit) | |||||
EPO signaling pathway | |||||
IL2 signaling events mediated by STAT5 | |||||
Validated targets of C-MYC transcriptional repression | |||||
Reactome | Activation of BAD and translocation to mitochondria | ||||
BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members | |||||
The NLRP1 inflammasome | |||||
WikiPathways | DNA Damage Response (only ATM dependent) | ||||
Senescence and Autophagy in Cancer | |||||
IL-2 Signaling Pathway | |||||
FAS pathway and Stress induction of HSP regulation | |||||
Focal Adhesion | |||||
Kit receptor signaling pathway | |||||
IL-3 Signaling Pathway | |||||
Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways | |||||
Apoptosis | |||||
Nanoparticle triggered autophagic cell death | |||||
Amyotrophic lateral sclerosis (ALS) | |||||
Integrated Pancreatic Cancer Pathway | |||||
Corticotropin-releasing hormone | |||||
Interleukin-11 Signaling Pathway | |||||
Prostate Cancer | |||||
miR-targeted genes in muscle cell - TarBase | |||||
miR-targeted genes in lymphocytes - TarBase | |||||
miR-targeted genes in leukocytes - TarBase | |||||
Integrated Breast Cancer Pathway | |||||
Integrated Cancer pathway | |||||
Intrinsic Pathway for Apoptosis | |||||
Apoptosis Modulation and Signaling | |||||
TP53 Network | |||||
Influenza A virus infection | |||||
IL-5 Signaling Pathway | |||||
References | |||||
Ref 467538 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4204). | ||||
Ref 521495 | ClinicalTrials.gov (NCT00024440) Fludarabine and Cyclophosphamide With or Without Oblimersen in Treating Patients With Relapsed or Refractory Chronic Lymphocytic Leukemia. U.S. National Institutes ofHealth. | ||||
Ref 521777 | ClinicalTrials.gov (NCT00268593) Pilot Efficacy Study of PI-88 With Docetaxel to Treat Prostate Cancer. U.S. National Institutes of Health. | ||||
Ref 522588 | ClinicalTrials.gov (NCT00848016) Gossypol Acetic Acid in Treating Patients With Recurrent, Metastatic, or Primary Adrenocortical Cancer That Cannot Be Removed By Surgery. U.S. National Institutes of Health. | ||||
Ref 524916 | ClinicalTrials.gov (NCT02242942) A Study to Compare the Efficacy and Safety of Obinutuzumab + GDC-0199 Versus Obinutuzumab + Chlorambucil in Patients With Chronic Lymphocytic Leukemia. U.S. National Institutes of Health. | ||||
Ref 526695 | Association between the photodynamic loss of Bcl-2 and the sensitivity to apoptosis caused by phthalocyanine photodynamic therapy. Photochem Photobiol. 2003 Jul;78(1):1-8. | ||||
Ref 527516 | Pharm Res. 2005 Mar;22(3):347-55.Intravenous hydrophobic drug delivery: a porous particle formulation of paclitaxel (AI-850). | ||||
Ref 528260 | Randomized phase III study of trastuzumab, paclitaxel, and carboplatin compared with trastuzumab and paclitaxel in women with HER-2-overexpressing metastatic breast cancer. J Clin Oncol. 2006 Jun 20;24(18):2786-92. | ||||
Ref 530307 | Paclitaxel directly binds to Bcl-2 and functionally mimics activity of Nur77. Cancer Res. 2009 Sep 1;69(17):6906-14. | ||||
Ref 531104 | Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9. | ||||
Ref 543024 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8269). | ||||
Ref 543069 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8318). | ||||
Ref 543070 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8319). | ||||
Ref 543071 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8320). | ||||
Ref 546653 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009496) | ||||
Ref 549281 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034622) | ||||
Ref 551729 | MGI PHARMA Initiates Drug Combination Trial of Irofulven and Taxotere in Patients With Advanced Cancers; Phase 1 Dose-Escalating Trial to Evaluate Novel Combination Therapy. 2001 Business Wire | ||||
Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
Ref 526031 | The binding conformation of Taxol in beta-tubulin: a model based on electron crystallographic density. Proc Natl Acad Sci U S A. 2001 Apr 24;98(9):5312-6. Epub 2001 Apr 17. | ||||
Ref 526209 | J Med Chem. 2001 Dec 6;44(25):4313-24.Discovery of small-molecule inhibitors of Bcl-2 through structure-based computer screening. | ||||
Ref 526695 | Association between the photodynamic loss of Bcl-2 and the sensitivity to apoptosis caused by phthalocyanine photodynamic therapy. Photochem Photobiol. 2003 Jul;78(1):1-8. | ||||
Ref 526976 | Antitumor activity of irofulven monotherapy and in combination with mitoxantrone or docetaxel against human prostate cancer models. Prostate. 2004 Apr 1;59(1):22-32. | ||||
Ref 527372 | The small-molecule Bcl-2 inhibitor HA14-1 interacts synergistically with flavopiridol to induce mitochondrial injury and apoptosis in human myeloma cells through a free radical-dependent and Jun NH2-terminal kinase-dependent mechanism. Mol Cancer Ther. 2004 Dec;3(12):1513-24. | ||||
Ref 527516 | Pharm Res. 2005 Mar;22(3):347-55.Intravenous hydrophobic drug delivery: a porous particle formulation of paclitaxel (AI-850). | ||||
Ref 527947 | Two concurrent phase II trials of paclitaxel/carboplatin/trastuzumab (weekly or every-3-week schedule) as first-line therapy in women with HER2-overexpressing metastatic breast cancer: NCCTG study 983252. Clin Breast Cancer. 2005 Dec;6(5):425-32. | ||||
Ref 528469 | J Med Chem. 2006 Oct 19;49(21):6139-42.Structure-based design of potent small-molecule inhibitors of anti-apoptotic Bcl-2 proteins. | ||||
Ref 528642 | J Med Chem. 2007 Feb 22;50(4):641-62. Epub 2007 Jan 26.Studies leading to potent, dual inhibitors of Bcl-2 and Bcl-xL. | ||||
Ref 529510 | WL-276, an antagonist against Bcl-2 proteins, overcomes drug resistance and suppresses prostate tumor growth. Cancer Res. 2008 Jun 1;68(11):4377-83. | ||||
Ref 530307 | Paclitaxel directly binds to Bcl-2 and functionally mimics activity of Nur77. Cancer Res. 2009 Sep 1;69(17):6906-14. | ||||
Ref 530520 | Multicentre phase I/II study of PI-88, a heparanase inhibitor in combination with docetaxel in patients with metastatic castrate-resistant prostate cancer. Ann Oncol. 2010 Jun;21(6):1302-7. | ||||
Ref 530890 | J Med Chem. 2010 May 27;53(10):3899-906.Vaccinia virus virulence factor N1L is a novel promising target for antiviral therapeutic intervention. | ||||
Ref 531104 | Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9. | ||||
Ref 532178 | ABT-199, a potent and selective BCL-2 inhibitor, achieves antitumor activity while sparing platelets. Nat Med. 2013 Feb;19(2):202-8. | ||||
Ref 536135 | Opportunities and challenges in antiparasitic drug discovery. Nat Rev Drug Discov. 2005 Sep;4(9):727-40. | ||||
Ref 536447 | Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52. | ||||
Ref 536702 | ABT-263: a potent and orally bioavailable Bcl-2 family inhibitor. Cancer Res. 2008 May 1;68(9):3421-8. | ||||
Ref 536883 | ABT-263 and rapamycin act cooperatively to kill lymphoma cells in vitro and in vivo. Mol Cancer Ther. 2008 Oct;7(10):3265-74. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.