Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T46828
|
||||
Former ID |
TTDS00015
|
||||
Target Name |
D(1B) dopamine receptor
|
||||
Gene Name |
DRD5
|
||||
Synonyms |
D(5) dopamine receptor; D(5)D(1B) dopamine receptor dopamine receptor; D1beta dopamine receptor; Dopamine receptor 5; DRD5
|
||||
Target Type |
Successful
|
||||
Disease | Allergy [ICD9: 995.3; ICD10: T78.4] | ||||
Schizophrenia [ICD9: 295; ICD10: F20] | |||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T46828
|
||||
UniProt ID | |||||
Sequence |
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH |
||||
Drugs and Mode of Action | |||||
Agonist | (+)-ADTN | Drug Info | [529311] | ||
beta-ergocriptine | Drug Info | [529311] | |||
N-propylnorapomorphine | Drug Info | [529311] | |||
Inhibitor | (+/-)-nantenine | Drug Info | [530558] | ||
1-(4-(4-phenyl-1-piperazinyl)butyl)indolin-2-one | Drug Info | [528904] | |||
1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine | Drug Info | [533570] | |||
1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine | Drug Info | [527160] | |||
1-[2-(2-Benzyl-phenoxy)-ethyl]-pyrrolidine | Drug Info | [527160] | |||
1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine | Drug Info | [527160] | |||
4-[2-(2-Benzyl-phenoxy)-ethyl]-morpholine | Drug Info | [527160] | |||
FLUMEZAPINE | Drug Info | [533515] | |||
FLUTROLINE | Drug Info | [533512] | |||
ISOCLOZAPINE | Drug Info | [533570] | |||
ISOLOXAPINE | Drug Info | [533577] | |||
Phenyltoloxamine | Drug Info | [527160] | |||
STEPHOLIDINE | Drug Info | [530374] | |||
Antagonist | GMC-283 | Drug Info | [536463] | ||
LE-300 | Drug Info | [536463] | |||
SKF-83556 | Drug Info | [529311] | |||
[125I]SCH23982 | Drug Info | [543568] | |||
[3H]SCH-23390 | Drug Info | [533868] | |||
Binder | ZD-3638 | Drug Info | [536463] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Calcium signaling pathway | ||||
cAMP signaling pathway | |||||
Neuroactive ligand-receptor interaction | |||||
Dopaminergic synapse | |||||
PANTHER Pathway | Dopamine receptor mediated signaling pathway | ||||
Reactome | Dopamine receptors | ||||
G alpha (s) signalling events | |||||
WikiPathways | Monoamine GPCRs | ||||
GPCRs, Class A Rhodopsin-like | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 524661 | ClinicalTrials.gov (NCT02076451) Open-label Study of DS-8273a to Assess Its Safety and Tolerability, and Assess Its Pharmacokinetic and Pharmacodynamic Properties in Subjects With Advanced Solid Tumors or Lymphomas. U.S. National Institutes of Health. | ||||
Ref 527160 | J Med Chem. 2004 Aug 12;47(17):4155-8.Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 receptor selectivity. | ||||
Ref 528904 | Bioorg Med Chem. 2007 Sep 1;15(17):5811-8. Epub 2007 Jun 7.Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand. | ||||
Ref 529311 | Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature. 1991 Apr 18;350(6319):614-9. | ||||
Ref 530374 | Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. Epub 2009 Aug 20.Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities?. | ||||
Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
Ref 533512 | J Med Chem. 1980 Jun;23(6):635-43.Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. | ||||
Ref 533515 | J Med Chem. 1982 Oct;25(10):1133-40.Effects of conformationally restricted 4-piperazinyl-10H-thienobenzodiazepine neuroleptics on central dopaminergic and cholinergic systems. | ||||
Ref 533570 | J Med Chem. 1982 Jul;25(7):855-8.Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. | ||||
Ref 533577 | J Med Chem. 1981 Sep;24(9):1021-6.Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. | ||||
Ref 533868 | Dopamine D5 receptors in human peripheral blood lymphocytes: a radioligand binding study. J Neuroimmunol. 1994 Aug;53(1):1-7. | ||||
Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.