Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T54771
|
||||
Former ID |
TTDC00260
|
||||
Target Name |
Sodium/glucose cotransporter 1
|
||||
Gene Name |
SLC5A1
|
||||
Synonyms |
High affinity sodium-glucose cotransporter; Na(+)/glucose cotransporter 1; Solute carrier family 5 member 1; SLC5A1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | ||||
Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
Function |
Actively transports glucose into cells by Na(+) cotransport with a Na(+) to glucose coupling ratio of 2:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
|
||||
BioChemical Class |
Solute:sodium symporter
|
||||
Target Validation |
T54771
|
||||
UniProt ID | |||||
Sequence |
MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFL
AGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIY IKAGVVTMPEYLRKRFGGQRIQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLA IFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAI PTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQR CLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVG CTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEK ELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRV NEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFIT IVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKG IFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCH AYFA |
||||
Drugs and Mode of Action | |||||
Inhibitor | 10-methoxy-N(1)-methylburnamine-17-O-veratrate | Drug Info | [530756] | ||
Acerogenin A | Drug Info | [530603] | |||
ACEROGENIN B | Drug Info | [530603] | |||
Alstiphyllanine D | Drug Info | [530756] | |||
Alstiphyllanine E | Drug Info | [530756] | |||
Alstiphyllanine F | Drug Info | [530756] | |||
Burnamine-17-O-3',4',5'-trimethoxybenzoate | Drug Info | [530756] | |||
KURAIDIN | Drug Info | [528742] | |||
KURARINONE | Drug Info | [528742] | |||
Kushenol N | Drug Info | [528742] | |||
LIK-066 | Drug Info | [543973] | |||
O-spiroketal glucoside | Drug Info | [530988] | |||
Phlorizin | Drug Info | [533444] | |||
QCP | Drug Info | [528982] | |||
QCPac | Drug Info | [528982] | |||
QNEQCPQVSac | Drug Info | [528982] | |||
QSPac | Drug Info | [528982] | |||
sergliflozin | Drug Info | [528482] | |||
Sophoraflavanone G | Drug Info | [528742] | |||
Modulator | 1614235 + 2330672 | Drug Info | [543973] | ||
LX-4211 | Drug Info | [531953] | |||
T-1095 | Drug Info | [525583] | |||
Blocker | GSK1614235 | Drug Info | [550963] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Carbohydrate digestion and absorption | ||||
Bile secretion | |||||
Mineral absorption | |||||
PathWhiz Pathway | Lactose Degradation | ||||
Trehalose Degradation | |||||
Reactome | Hexose transport | ||||
Na+-dependent glucose transporters | |||||
Inositol transporters | |||||
WikiPathways | NRF2 pathway | ||||
Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds | |||||
Metabolism of carbohydrates | |||||
References | |||||
Ref 523921 | ClinicalTrials.gov (NCT01607385) A Study to Evaluate the Safety, Tolerability, Pharmacokinetic a Single Day of Dosing With GSK1614235.. U.S. National Institutes of Health. | ||||
Ref 524151 | ClinicalTrials.gov (NCT01742208) Safety and Efficacy of LX4211 in Patients With Inadequately Controlled Type 1 Diabetes Mellitus. U.S. National Institutes of Health. | ||||
Ref 524252 | ClinicalTrials.gov (NCT01824264) Dose-finding Study of LIK066 Compared With Placebo or Sitagliptin to Evaluate Change in HbA1c in Patients With Diabetes. U.S. National Institutes of Health. | ||||
Ref 543064 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8312). | ||||
Ref 525583 | T-1095, an inhibitor of renal Na+-glucose cotransporters, may provide a novel approach to treating diabetes. Diabetes. 1999 Sep;48(9):1794-800. | ||||
Ref 528482 | Sergliflozin, a novel selective inhibitor of low-affinity sodium glucose cotransporter (SGLT2), validates the critical role of SGLT2 in renal glucose reabsorption and modulates plasma glucose level. J Pharmacol Exp Ther. 2007 Jan;320(1):323-30. Epub 2006 Oct 18. | ||||
Ref 528742 | Bioorg Med Chem. 2007 May 15;15(10):3445-9. Epub 2007 Mar 12.Na+-glucose cotransporter (SGLT) inhibitory flavonoids from the roots of Sophora flavescens. | ||||
Ref 528982 | J Biol Chem. 2007 Sep 28;282(39):28501-13. Epub 2007 Aug 8.Tripeptides of RS1 (RSC1A1) inhibit a monosaccharide-dependent exocytotic pathway of Na+-D-glucose cotransporter SGLT1 with high affinity. | ||||
Ref 530603 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):1070-4. Epub 2009 Dec 11.Cyclic diarylheptanoids as Na+-glucose cotransporter (SGLT) inhibitors from Acer nikoense. | ||||
Ref 530756 | Bioorg Med Chem. 2010 Mar 15;18(6):2152-8. Epub 2010 Feb 6.Alstiphyllanines E-H, picraline and ajmaline-type alkaloids from Alstonia macrophylla inhibiting sodium glucose cotransporter. | ||||
Ref 530988 | Bioorg Med Chem. 2010 Jun 15;18(12):4422-32. Epub 2010 Apr 29.ortho-Substituted C-aryl glucosides as highly potent and selective renal sodium-dependent glucose co-transporter 2 (SGLT2) inhibitors. | ||||
Ref 531953 | LX4211, a dual SGLT1/SGLT2 inhibitor, improved glycemic control in patients with type 2 diabetes in a randomized, placebo-controlled trial. Clin Pharmacol Ther. 2012 Aug;92(2):158-69. | ||||
Ref 533444 | J Biol Chem. 1988 Jan 5;263(1):187-92.High affinity phlorizin binding to the LLC-PK1 cells exhibits a sodium:phlorizin stoichiometry of 2:1. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.