Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T54902
|
||||
Former ID |
TTDI02106
|
||||
Target Name |
CD158b1
|
||||
Gene Name |
KIR2DL2
|
||||
Synonyms |
CD158 antigenlike family member B1; Killer cell immunoglobulinlike receptor 2DL2; MHC class I NK cell receptor; NKAT6; Natural killerassociated transcript 6; p58 NK receptor CL43; p58 natural killer cell receptor clone CL43; KIR2DL2
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | ||||
Multiple myeloma [ICD9: 203; ICD10: C90] | |||||
Function |
Receptor on natural killer (NK) cells for HLA-Cw1, 3,7, and 8 allotypes. Inhibits the activity of NK cells thus preventing cell lysis.
|
||||
BioChemical Class |
Immunoglobulin
|
||||
UniProt ID | |||||
Sequence |
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGT FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGN PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Antigen processing and presentation | ||||
Natural killer cell mediated cytotoxicity | |||||
Graft-versus-host disease | |||||
NetPath Pathway | IL2 Signaling Pathway | ||||
Reactome | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
WikiPathways | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
References | |||||
Ref 524057 | ClinicalTrials.gov (NCT01687387) Efficacy Study of Anti-KIR Monoclonal Antibody as Maintenance Treatment in Acute Myeloid Leukemia (EFFIKIR). U.S. National Institutes of Health. | ||||
Ref 530228 | Preclinical characterization of 1-7F9, a novel human anti-KIR receptor therapeutic antibody that augments natural killer-mediated killing of tumor cells. Blood. 2009 Sep 24;114(13):2667-77. | ||||
Ref 530238 | Genetic and antibody-mediated reprogramming of natural killer cell missing-self recognition in vivo. Proc Natl Acad Sci U S A. 2009 Aug 4;106(31):12879-84. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.