Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T63595
|
||||
| Former ID |
TTDR00518
|
||||
| Target Name |
High mobility group protein 1
|
||||
| Gene Name |
HMGB1
|
||||
| Synonyms |
HMG-1; High mobility group box chromosomal protein 1; HMGB1
|
||||
| Target Type |
Research
|
||||
| Function |
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells (By similarity).
|
||||
| BioChemical Class |
High mobility group box
|
||||
| UniProt ID | |||||
| Sequence |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
||||
| Pathways | |||||
| KEGG Pathway | Base excision repair | ||||
| NetPath Pathway | TSH Signaling Pathway | ||||
| TCR Signaling Pathway | |||||
| PANTHER Pathway | p53 pathway | ||||
| Pathway Interaction Database | Beta3 integrin cell surface interactions | ||||
| amb2 Integrin signaling | |||||
| Endogenous TLR signaling | |||||
| Reactome | RIP-mediated NFkB activation via ZBP1 | ||||
| Activation of DNA fragmentation factor | |||||
| DEx/H-box helicases activate type I IFN and inflammatory cytokines production | |||||
| TAK1 activates NFkB by phosphorylation and activation of IKKs complex | |||||
| Advanced glycosylation endproduct receptor signaling | |||||
| TRAF6 mediated NF-kB activation | |||||
| WikiPathways | DNA Damage Response (only ATM dependent) | ||||
| Cytosolic sensors of pathogen-associated DNA | |||||
| TAK1 activates NFkB by phosphorylation and activation of IKKs complex | |||||
| Retinoblastoma (RB) in Cancer | |||||
| RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways | |||||
| Apoptotic execution phase | |||||
| Advanced glycosylation endproduct receptor signaling | |||||
| References | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

