Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T64795
|
||||
| Former ID |
TTDS00161
|
||||
| Target Name |
Voltage-dependent T-type calcium channel alpha-1G subunit
|
||||
| Gene Name |
CACNA1G
|
||||
| Synonyms |
Cav; Cav3.1c; NBR13; Voltage-dependent T-type calcium channel; Voltage-gated calcium channel alpha subunit Cav3.1; CACNA1G
|
||||
| Target Type |
Successful
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Epilepsy [ICD10: G40] | |||||
| Epileptic seizures [ICD9: 345.9, 780.3; ICD10: G40, P90, R56] | |||||
| Epileptic conditions; Pancreatic cancer [ICD9:345, 140-199, 140-229, 157, 210-229; ICD10: G40, C25] | |||||
| Hypertension; Angina [ICD9: 401, 413; ICD10: I10-I16, I20] | |||||
| Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
| Paramethadione syndrome; Seizures [ICD9:741, 744, 745, 746, 751, 753, 345.9, 780.3; ICD10: Q05, Q17, Q20-Q28, Q60, Q79, G40, P90, R56] | |||||
| Schizophrenia [ICD9: 295; ICD10: F20] | |||||
| Function |
Voltage-sensitive calcium channels (vscc) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release and gene expression.
|
||||
| BioChemical Class |
Calcium channel
|
||||
| Target Validation |
T64795
|
||||
| UniProt ID | |||||
| Sequence |
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR CFLPENFSLPLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGDGGGGPPCGL DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSS SCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTP ALSGAPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE TLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCLKADSG ACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRSLGPDA EPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV AILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDANKSESEPDFFSPSLDGDGDRKKCL ALVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA HEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQ DEEESSEEERASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCN GKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFP PQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAV FLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVL RLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFV CQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVG VDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRL RRLEKKRRNLMLDDVIASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGV IGLNVVTMAMEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDL AIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQAL PQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVST GDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKE AKEEAELEAELELEMKTLSPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASH FSLEHPTDRQLFDTISLLIQGSLEWELKLMDELAGPGGQPSAFPSAPSLGGSDPQIPLAE MEALSLTSEIVSEPSCSLALTDDSLPDDMHTLLLSALESNMQPHPTELPGPDLLTVRKSG VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTSYILQLPKDAP HLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDLLAEVSGPS PPLARAYSFWGQSSTQAQQHSRSHSKISKHMTPPAPCPGPEPNWGKGPPETRSSLELDTE LSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQSCQRRPTSWLDEQRRHSIAVSCLDSGSQ PHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDS KDPLASGPPDSMAASPSPKKDVLSLSGLSSDPADLDP |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ethosuximide | Drug Info | Approved | Epilepsy | [538174], [542193] |
| Methsuximide | Drug Info | Approved | Epileptic seizures | [538431], [542243] | |
| Paramethadione | Drug Info | Approved | Paramethadione syndrome; Seizures | [538397], [542280], [551871] | |
| Penfluridol | Drug Info | Approved | Schizophrenia | [551871] | |
| Trimethadione | Drug Info | Approved | Epileptic conditions; Pancreatic cancer | [538387], [542339], [551871] | |
| Verapamil | Drug Info | Approved | Hypertension; Angina | [536619], [539535] | |
| PD-200390 | Drug Info | Phase 2 | Insomnia | [530573] | |
| Blocker (channel blocker) | (-)-(R)-efonidipine | Drug Info | [527288] | ||
| ML218 | Drug Info | [531818] | |||
| Blocker | Alpha-methyl-alpha-phenylsuccinimide (MPS) | Drug Info | [535283] | ||
| Diphenylbutylpiperidines pimozide | Drug Info | [535338] | |||
| Ethosuximide | Drug Info | [535142], [535283], [536932] | |||
| Methsuximide | Drug Info | [535283] | |||
| Nickel chloride | Drug Info | [538044] | |||
| Paramethadione | Drug Info | [536353] | |||
| Penfluridol | Drug Info | [535338] | |||
| Trimethadione | Drug Info | [536353] | |||
| Verapamil | Drug Info | [536067], [538057] | |||
| Inhibitor | Cis-N,5-dibenzyl-6-oxomorpholine-3-carboxamide | Drug Info | [528344] | ||
| KKHT-10318 | Drug Info | [528476] | |||
| KKHT-10608 | Drug Info | [528476] | |||
| KKHT-10609 | Drug Info | [528476] | |||
| KKHT-10613 | Drug Info | [528476] | |||
| KKHT-10618 | Drug Info | [528476] | |||
| KKHT-11018 | Drug Info | [528476] | |||
| KKHT-20718 | Drug Info | [528476] | |||
| KKHT-20818 | Drug Info | [528476] | |||
| KKHT-20918 | Drug Info | [528476] | |||
| KYS-05001 | Drug Info | [529044] | |||
| KYS-05040 | Drug Info | [527099] | |||
| KYS-05041 | Drug Info | [528504] | |||
| KYS-05042 | Drug Info | [529566] | |||
| KYS-05050 | Drug Info | [528495] | |||
| KYS-05055 | Drug Info | [529566] | |||
| KYS-05056 | Drug Info | [529566] | |||
| KYS-05057 | Drug Info | [529566] | |||
| KYS-05064 | Drug Info | [528504] | |||
| KYS-05065 | Drug Info | [529566] | |||
| KYS-05070 | Drug Info | [528345] | |||
| KYS-05071 | Drug Info | [528345] | |||
| KYS-05074 | Drug Info | [528345] | |||
| KYS-05077 | Drug Info | [528495] | |||
| KYS-05080 | Drug Info | [529566] | |||
| KYS-05090 | Drug Info | [529566] | |||
| Modulator | PD-200390 | Drug Info | [549974] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Calcium signaling pathway | |||||
| Circadian entrainment | |||||
| Type II diabetes mellitus | |||||
| PANTHER Pathway | Endogenous cannabinoid signaling | ||||
| GABA-B receptor II signaling | |||||
| Nicotine pharmacodynamics pathway | |||||
| Pathway Interaction Database | Regulation of nuclear beta catenin signaling and target gene transcription | ||||
| PathWhiz Pathway | Muscle/Heart Contraction | ||||
| Reactome | NCAM1 interactions | ||||
| WikiPathways | NCAM signaling for neurite out-growth | ||||
| Nicotine Activity on Chromaffin Cells | |||||
| References | |||||
| Ref 530573 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):461-4. Epub 2009 Nov 27.Synthesis and in vivo evaluation of bicyclic gababutins. | ||||
| Ref 536619 | Partial restoration of mutant enzyme homeostasis in three distinct lysosomal storage disease cell lines by altering calcium homeostasis. PLoS Biol. 2008 Feb;6(2):e26. | ||||
| Ref 538174 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040253. | ||||
| Ref 538387 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 005856. | ||||
| Ref 538397 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 006800. | ||||
| Ref 538431 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010596. | ||||
| Ref 539535 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2406). | ||||
| Ref 542193 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7182). | ||||
| Ref 542243 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7228). | ||||
| Ref 542280 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7261). | ||||
| Ref 527099 | Bioorg Med Chem Lett. 2004 Jul 5;14(13):3379-84.3,4-Dihydroquinazoline derivatives as novel selective T-type Ca2+ channel blockers. | ||||
| Ref 527288 | Identification of R(-)-isomer of efonidipine as a selective blocker of T-type Ca2+ channels. Br J Pharmacol. 2004 Dec;143(8):1050-7. Epub 2004 Nov 15. | ||||
| Ref 528344 | Bioorg Med Chem Lett. 2006 Oct 1;16(19):5244-8. Epub 2006 Jul 28.Morpholin-2-one derivatives as novel selective T-type Ca2+ channel blockers. | ||||
| Ref 528345 | Bioorg Med Chem Lett. 2006 Oct 1;16(19):5014-7. Epub 2006 Jul 28.Growth inhibition of human cancer cells in vitro by T-type calcium channel blockers. | ||||
| Ref 528476 | Bioorg Med Chem. 2007 Jan 1;15(1):365-73. Epub 2006 Oct 10.Novel T-type calcium channel blockers: dioxoquinazoline carboxamide derivatives. | ||||
| Ref 528495 | Bioorg Med Chem Lett. 2007 Jan 15;17(2):471-5. Epub 2006 Oct 12.Synthesis and biological evaluation of novel T-type calcium channel blockers. | ||||
| Ref 528504 | Bioorg Med Chem. 2007 Jan 15;15(2):1091-105. Epub 2006 Oct 30.3D pharmacophore based virtual screening of T-type calcium channel blockers. | ||||
| Ref 529044 | Bioorg Med Chem Lett. 2007 Nov 1;17(21):5740-3. Epub 2007 Sep 1.Discovery of potent T-type calcium channel blocker. | ||||
| Ref 529566 | Bioorg Med Chem Lett. 2008 Jul 15;18(14):3899-901. Epub 2008 Jun 14.T-type Ca2+ channel blockers suppress the growth of human cancer cells. | ||||
| Ref 531818 | The Discovery and Characterization of ML218: A Novel, Centrally Active T-Type Calcium Channel Inhibitor with Robust Effects in STN Neurons and in a Rodent Model of Parkinson's Disease. ACS Chem Neurosci. 2011 Dec 21;2(12):730-742. | ||||
| Ref 535142 | Effects of ethosuximide, a T-type Ca(2+) channel blocker, on dorsal horn neuronal responses in rats. Eur J Pharmacol. 2001 Mar;415(2-3):141-9. | ||||
| Ref 535283 | Block of cloned human T-type calcium channels by succinimide antiepileptic drugs. Mol Pharmacol. 2001 Nov;60(5):1121-32. | ||||
| Ref 535338 | Differential inhibition of T-type calcium channels by neuroleptics. J Neurosci. 2002 Jan 15;22(2):396-403. | ||||
| Ref 536067 | Mechanism of tissue-selective drug action in the cardiovascular system. Mol Interv. 2005 Apr;5(2):84-93. | ||||
| Ref 536353 | Prophylactic and therapeutic functions of T-type calcium blockers against noise-induced hearing loss. Hear Res. 2007 Apr;226(1-2):52-60. Epub 2006 Dec 31. | ||||
| Ref 536932 | Maladaptive homeostatic plasticity in a rodent model of central pain syndrome: thalamic hyperexcitability after spinothalamic tract lesions. J Neurosci. 2008 Nov 12;28(46):11959-69. | ||||
| Ref 538044 | T-type calcium channels facilitate insulin secretion by enhancing general excitability in the insulin-secreting beta-cell line, INS-1. Endocrinology. 1997 Sep;138(9):3735-40. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

