Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T65019
|
||||
| Former ID |
TTDC00042
|
||||
| Target Name |
Matrix metalloproteinase-14
|
||||
| Gene Name |
MMP14
|
||||
| Synonyms |
MMP-14; MMP-X1; MT-MMP 1; MT1-MMP; MT1MMP; MTMMP1; Membrane-type matrix metalloproteinase 1; Membrane-type-1 matrix metalloproteinase; MMP14
|
||||
| Target Type |
Research
|
||||
| Disease | Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | ||||
| Function |
Seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization bycleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro- MMP2.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T65019
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.24.80
|
||||
| Sequence |
MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 2-(4-bromophenylsulfonamido)-N-hydroxyacetamide | Drug Info | [530746] | ||
| 2-(biphenyl-4-ylsulfonamido)-N-hydroxyacetamide | Drug Info | [530746] | |||
| 2-(Biphenyl-4-ylsulfonyl)N-hydroxybenzamide | Drug Info | [530402] | |||
| compound 29e | Drug Info | [532333] | |||
| DX-2400 | Drug Info | [543455] | |||
| EPIGALOCATECHIN GALLATE | Drug Info | [530210] | |||
| IK-682 | Drug Info | [526446] | |||
| ILOMASTAT | Drug Info | [529683] | |||
| MMI270 | Drug Info | [528548] | |||
| N-hydroxy-2-(4-methoxyphenylsulfonamido)acetamide | Drug Info | [530746] | |||
| N-Hydroxy-2-(4-phenoxy-benzenesulfonyl)benzamide | Drug Info | [530402] | |||
| SR-973 | Drug Info | [528025] | |||
| UK-356618 | Drug Info | [526680] | |||
| [2-(Biphenyl-4-sulfonyl)phenyl]acetic Acid | Drug Info | [530402] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | TNF signaling pathway | ||||
| GnRH signaling pathway | |||||
| PANTHER Pathway | Alzheimer disease-presenilin pathway | ||||
| Pathway Interaction Database | HIF-2-alpha transcription factor network | ||||
| Signaling events mediated by focal adhesion kinase | |||||
| Reactome | Collagen degradation | ||||
| Degradation of the extracellular matrix | |||||
| Activation of Matrix Metalloproteinases | |||||
| WikiPathways | Senescence and Autophagy in Cancer | ||||
| Activation of Matrix Metalloproteinases | |||||
| Degradation of collagen | |||||
| AGE/RAGE pathway | |||||
| Matrix Metalloproteinases | |||||
| References | |||||
| Ref 526446 | J Med Chem. 2002 Nov 7;45(23):4954-7.Discovery of gamma-lactam hydroxamic acids as selective inhibitors of tumor necrosis factor alpha converting enzyme: design, synthesis, and structure-activity relationships. | ||||
| Ref 526680 | J Med Chem. 2003 Jul 31;46(16):3514-25.A potent, selective inhibitor of matrix metalloproteinase-3 for the topical treatment of chronic dermal ulcers. | ||||
| Ref 528025 | Bioorg Med Chem Lett. 2006 May 1;16(9):2357-63. Epub 2006 Feb 10.Synthesis and evaluation of succinoyl-caprolactam gamma-secretase inhibitors. | ||||
| Ref 528548 | Bioorg Med Chem. 2007 Feb 1;15(3):1266-74. Epub 2006 Nov 14.Methotrexate gamma-hydroxamate derivatives as potential dual target antitumor drugs. | ||||
| Ref 529683 | Bioorg Med Chem. 2008 Sep 15;16(18):8745-59. Epub 2008 Jul 20.Introduction of the 4-(4-bromophenyl)benzenesulfonyl group to hydrazide analogs of Ilomastat leads to potent gelatinase B (MMP-9) inhibitors with improved selectivity. | ||||
| Ref 530210 | Bioorg Med Chem Lett. 2009 Aug 1;19(15):4171-4. Epub 2009 Jun 2.Regioselective synthesis of methylated epigallocatechin gallate via nitrobenzenesulfonyl (Ns) protecting group. | ||||
| Ref 530402 | J Med Chem. 2009 Oct 22;52(20):6347-61.Design, synthesis, biological evaluation, and NMR studies of a new series of arylsulfones as selective and potent matrix metalloproteinase-12 inhibitors. | ||||
| Ref 530746 | J Med Chem. 2010 Mar 25;53(6):2622-35.Potent arylsulfonamide inhibitors of tumor necrosis factor-alpha converting enzyme able to reduce activated leukocyte cell adhesion molecule shedding in cancer cell models. | ||||
| Ref 532333 | Matrix metalloproteinase inhibitors based on the 3-mercaptopyrrolidine core. J Med Chem. 2013 Jun 13;56(11):4357-73. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

