Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T71377
|
||||
| Former ID |
TTDR00012
|
||||
| Target Name |
Interleukin 3 receptor
|
||||
| Gene Name |
IL3RA
|
||||
| Synonyms |
CD123 antigen; IL-3R-alpha; IL3RA
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Acute lymphoblastic leukemia; Acute myeloid lymphoma [ICD9:204.0, 556; ICD10: C91.0, C92.0] | ||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Osteoporosis [ICD9: 733.0, V07.4; ICD10: M80-M81, Z79.890] | |||||
| Function |
This is a receptor for interleukin-3.
|
||||
| BioChemical Class |
Cytokine receptor
|
||||
| UniProt ID | |||||
| Sequence |
MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSM
PAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFL SCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYEL QIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGAN TRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAG KAGLEECLVTEVQVVQKT |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| PI3K-Akt signaling pathway | |||||
| Apoptosis | |||||
| Jak-STAT signaling pathway | |||||
| Hematopoietic cell lineage | |||||
| NetPath Pathway | IL5 Signaling Pathway | ||||
| IL3 Signaling Pathway | |||||
| Pathway Interaction Database | IL3-mediated signaling events | ||||
| Reactome | GPVI-mediated activation cascade | ||||
| gamma signalling through PI3Kgamma | |||||
| Interleukin-3, 5 and GM-CSF signaling | |||||
| RAF/MAP kinase cascade | |||||
| Interleukin receptor SHC signaling | |||||
| WikiPathways | IL-3 Signaling Pathway | ||||
| Interleukin-2 signaling | |||||
| Interleukin-3, 5 and GM-CSF signaling | |||||
| References | |||||
| Ref 544458 | A Phase I trial of MGD006 in patients with relapsed acute myeloid leukemia (AML). J Immunother Cancer. 2014; 2(Suppl 3): P87. | ||||
| Ref 546034 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005988) | ||||
| Ref 532602 | Monoclonal antibody targeting of IL-3 receptor alpha with CSL362 effectively depletes CML progenitor and stem cells. Blood. 2014 Feb 20;123(8):1218-28. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

