Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T74238
|
||||
| Former ID |
TTDI01916
|
||||
| Target Name |
Leukotriene CysLT2 receptor
|
||||
| Gene Name |
CYSLTR2
|
||||
| Synonyms |
CysLTR2; Cysteinyl leukotriene receptor 2; Gprotein coupled receptor GPCR21; Gprotein coupled receptor HG57; HPN321; hGPCR21; CYSLTR2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Asthma [ICD10: J45] | ||||
| Unspecified [ICD code not available] | |||||
| Function |
Receptor for cysteinyl leukotrienes. The response is mediated via a G-protein that activates a phosphatidylinositol- calcium second messenger system. Stimulation by BAY u9773, a partial agonist, induces specific contractions of pulmonary veinsand might also have an indirect role in the relaxation of the pulmonary vascular endothelium. The rank order of affinities for the leukotrienes is LTC4 = LTD4 >> LTE4.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| UniProt ID | |||||
| Sequence |
MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV NMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV SHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACF NPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | BAY-X-7195 | Drug Info | Phase 2 | Asthma | [545585] |
| AS-35 | Drug Info | Discontinued in Phase 2 | Asthma | [544897] | |
| DS-4574 | Drug Info | Discontinued in Phase 2 | Asthma | [544688] | |
| Sulukast | Drug Info | Discontinued in Phase 2 | Asthma | [540287], [544541] | |
| FPL-55712 | Drug Info | Terminated | Asthma | [544540] | |
| LY-290154 | Drug Info | Terminated | Asthma | [546276] | |
| MDL-43291 | Drug Info | Terminated | Asthma | [544539] | |
| Modulator | AS-35 | Drug Info | [526815] | ||
| BAY-X-7195 | Drug Info | ||||
| CGP-57698 | Drug Info | ||||
| DS-4574 | Drug Info | [533854] | |||
| FPL-55712 | Drug Info | [529534] | |||
| LY-290154 | Drug Info | ||||
| MDL-43291 | Drug Info | ||||
| Sulukast | Drug Info | ||||
| Antagonist | BayCysLT2 | Drug Info | [531556] | ||
| BAYu9773 | Drug Info | [533700] | |||
| HAMI3379 | Drug Info | [530873] | |||
| pobilukast | Drug Info | [543686] | |||
| [3H]ICI-198615 | Drug Info | [526751] | |||
| Agonist | LTC4 | Drug Info | [525921] | ||
| LTD4 | Drug Info | [525921] | |||
| LTE4 | Drug Info | [531263] | |||
| N-methyl LTC4 | Drug Info | [531263] | |||
| [3H]LTC4 | Drug Info | [525835] | |||
| [3H]LTD4 | Drug Info | [525790] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Calcium signaling pathway | ||||
| Neuroactive ligand-receptor interaction | |||||
| NetPath Pathway | IL4 Signaling Pathway | ||||
| IL3 Signaling Pathway | |||||
| Pathway Interaction Database | Endothelins | ||||
| Reactome | Leukotriene receptors | ||||
| G alpha (q) signalling events | |||||
| WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 540287 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3327). | ||||
| Ref 544539 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000087) | ||||
| Ref 544540 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000089) | ||||
| Ref 544541 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000090) | ||||
| Ref 544688 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000587) | ||||
| Ref 544897 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001439) | ||||
| Ref 525790 | Characterization of the human cysteinyl leukotriene 2 receptor. J Biol Chem. 2000 Sep 29;275(39):30531-6. | ||||
| Ref 525835 | The molecular characterization and tissue distribution of the human cysteinyl leukotriene CysLT(2) receptor. Biochem Biophys Res Commun. 2000 Aug 2;274(2):316-22. | ||||
| Ref 525921 | Molecular cloning and characterization of a second human cysteinyl leukotriene receptor: discovery of a subtype selective agonist. Mol Pharmacol. 2000 Dec;58(6):1601-8. | ||||
| Ref 526751 | Heterogeneity of binding sites for ICI 198,615 in human lung parenchyma. Biochem Pharmacol. 1992 Oct 6;44(7):1411-5. | ||||
| Ref 526815 | Peptide leukotriene antagonistic activity of AS-35, a new antiallergic drug. Jpn J Pharmacol. 1992 Apr;58(4):347-55. | ||||
| Ref 529534 | Effect of the leukotriene receptor antagonists FPL 55712, LY 163443, and MK-571 on the elimination of cysteinyl leukotrienes in the rat. Br J Pharmacol. 1991 Apr;102(4):865-70. | ||||
| Ref 530873 | Pharmacological characterization of the first potent and selective antagonist at the cysteinyl leukotriene 2 (CysLT(2)) receptor. Br J Pharmacol. 2010 May;160(2):399-409. | ||||
| Ref 531263 | Differential signaling of cysteinyl leukotrienes and a novel cysteinyl leukotriene receptor 2 (CysLT?? agonist, N-methyl-leukotriene C?? in calcium reporter and beta arrestin assays. Mol Pharmacol. 2011 Feb;79(2):270-8. | ||||
| Ref 531556 | Synthesis of cysteinyl leukotrienes in human endothelial cells: subcellular localization and autocrine signaling through the CysLT2 receptor. FASEB J. 2011 Oct;25(10):3519-28. | ||||
| Ref 533700 | BAY u9773, a novel antagonist of cysteinyl-leukotrienes with activity against two receptor subtypes. Eur J Pharmacol. 1994 Nov 3;264(3):317-23. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

