Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T84397
|
||||
| Former ID |
TTDI00967
|
||||
| Target Name |
Tubulin beta-1 chain
|
||||
| Gene Name |
TUBB1
|
||||
| Synonyms |
TUBB1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Lung cancer [ICD9: 162; ICD10: C33-C34] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain (By similarity).
|
||||
| BioChemical Class |
Tubulin family
|
||||
| UniProt ID | |||||
| Sequence |
MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYV
PRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVV RHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVV EPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSL RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTM AACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRG LSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVS EYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| KEGG Pathway | Phagosome | ||||
| Gap junction | |||||
| Pathogenic Escherichia coli infection | |||||
| NetPath Pathway | TSH Signaling Pathway | ||||
| PANTHER Pathway | Cytoskeletal regulation by Rho GTPase | ||||
| Huntington disease | |||||
| Reactome | Translocation of GLUT4 to the plasma membrane | ||||
| Microtubule-dependent trafficking of connexons from Golgi to the plasma membrane | |||||
| Gap junction assembly | |||||
| MHC class II antigen presentation | |||||
| Separation of Sister Chromatids | |||||
| Resolution of Sister Chromatid Cohesion | |||||
| Recruitment of NuMA to mitotic centrosomes | |||||
| Post-chaperonin tubulin folding pathway | |||||
| Recycling pathway of L1 | |||||
| Hedgehog ' | |||||
| off' | |||||
| state | |||||
| Assembly of the primary cilium | |||||
| RHO GTPases activate IQGAPs | |||||
| RHO GTPases Activate Formins | |||||
| Mitotic Prometaphase | |||||
| Kinesins | |||||
| WikiPathways | Parkin-Ubiquitin Proteasomal System pathway | ||||
| Pathogenic Escherichia coli infection | |||||
| Protein folding | |||||
| References | |||||
| Ref 521777 | ClinicalTrials.gov (NCT00268593) Pilot Efficacy Study of PI-88 With Docetaxel to Treat Prostate Cancer. U.S. National Institutes of Health. | ||||
| Ref 527516 | Pharm Res. 2005 Mar;22(3):347-55.Intravenous hydrophobic drug delivery: a porous particle formulation of paclitaxel (AI-850). | ||||
| Ref 526976 | Antitumor activity of irofulven monotherapy and in combination with mitoxantrone or docetaxel against human prostate cancer models. Prostate. 2004 Apr 1;59(1):22-32. | ||||
| Ref 527516 | Pharm Res. 2005 Mar;22(3):347-55.Intravenous hydrophobic drug delivery: a porous particle formulation of paclitaxel (AI-850). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

