Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T84397
|
||||
Former ID |
TTDI00967
|
||||
Target Name |
Tubulin beta-1 chain
|
||||
Gene Name |
TUBB1
|
||||
Synonyms |
TUBB1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
Lung cancer [ICD9: 162; ICD10: C33-C34] | |||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain (By similarity).
|
||||
BioChemical Class |
Tubulin family
|
||||
UniProt ID | |||||
Sequence |
MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYV
PRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVV RHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVV EPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSL RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTM AACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRG LSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVS EYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH |
||||
Drugs and Mode of Action | |||||
Pathways | |||||
KEGG Pathway | Phagosome | ||||
Gap junction | |||||
Pathogenic Escherichia coli infection | |||||
NetPath Pathway | TSH Signaling Pathway | ||||
PANTHER Pathway | Cytoskeletal regulation by Rho GTPase | ||||
Huntington disease | |||||
Reactome | Translocation of GLUT4 to the plasma membrane | ||||
Microtubule-dependent trafficking of connexons from Golgi to the plasma membrane | |||||
Gap junction assembly | |||||
MHC class II antigen presentation | |||||
Separation of Sister Chromatids | |||||
Resolution of Sister Chromatid Cohesion | |||||
Recruitment of NuMA to mitotic centrosomes | |||||
Post-chaperonin tubulin folding pathway | |||||
Recycling pathway of L1 | |||||
Hedgehog ' | |||||
off' | |||||
state | |||||
Assembly of the primary cilium | |||||
RHO GTPases activate IQGAPs | |||||
RHO GTPases Activate Formins | |||||
Mitotic Prometaphase | |||||
Kinesins | |||||
WikiPathways | Parkin-Ubiquitin Proteasomal System pathway | ||||
Pathogenic Escherichia coli infection | |||||
Protein folding | |||||
References | |||||
Ref 521777 | ClinicalTrials.gov (NCT00268593) Pilot Efficacy Study of PI-88 With Docetaxel to Treat Prostate Cancer. U.S. National Institutes of Health. | ||||
Ref 527516 | Pharm Res. 2005 Mar;22(3):347-55.Intravenous hydrophobic drug delivery: a porous particle formulation of paclitaxel (AI-850). | ||||
Ref 526976 | Antitumor activity of irofulven monotherapy and in combination with mitoxantrone or docetaxel against human prostate cancer models. Prostate. 2004 Apr 1;59(1):22-32. | ||||
Ref 527516 | Pharm Res. 2005 Mar;22(3):347-55.Intravenous hydrophobic drug delivery: a porous particle formulation of paclitaxel (AI-850). |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.