Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T85616
|
||||
| Former ID |
TTDC00075
|
||||
| Target Name |
Thioredoxin
|
||||
| Gene Name |
TXN
|
||||
| Synonyms |
ADF; ATL-derived factor; SASP; Surface associated sulphydryl protein; TXN
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Function |
ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55).
|
||||
| BioChemical Class |
Thioredoxin
|
||||
| Target Validation |
T85616
|
||||
| UniProt ID | |||||
| Sequence |
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| RANKL Signaling Pathway | |||||
| PANTHER Pathway | Hypoxia response via HIF activation | ||||
| Oxidative stress response | |||||
| Pathway Interaction Database | p38 MAPK signaling pathway | ||||
| Signaling events mediated by PTP1B | |||||
| TNF receptor signaling pathway | |||||
| PathWhiz Pathway | Purine Metabolism | ||||
| Reactome | Oxidative Stress Induced Senescence | ||||
| Detoxification of Reactive Oxygen Species | |||||
| TP53 Regulates Metabolic Genes | |||||
| The NLRP3 inflammasome | |||||
| WikiPathways | NRF2 pathway | ||||
| Nuclear Receptors Meta-Pathway | |||||
| Detoxification of Reactive Oxygen Species | |||||
| Human Complement System | |||||
| Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways | |||||
| TNF alpha Signaling Pathway | |||||
| Metabolism of nucleotides | |||||
| Selenium Micronutrient Network | |||||
| References | |||||
| Ref 536388 | A Phase I pharmacokinetic and pharmacodynamic study of PX-12, a novel inhibitor of thioredoxin-1, in patients with advanced solid tumors. Clin Cancer Res. 2007 Apr 1;13(7):2109-14. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

