Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T88285
|
||||
Former ID |
TTDR01246
|
||||
Target Name |
Lactoylglutathione lyase
|
||||
Gene Name |
GLO1
|
||||
Synonyms |
Aldoketomutase; Glx I; GlxI; Glyoxalase I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; GLO1
|
||||
Target Type |
Clinical Trial
|
||||
Function |
Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF- kappa-B. Required for normal osteoclastogenesis.
|
||||
BioChemical Class |
Carbon-sulfur lyases
|
||||
Target Validation |
T88285
|
||||
UniProt ID | |||||
EC Number |
EC 4.4.1.5
|
||||
Sequence |
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM ATLM |
||||
Drugs and Mode of Action | |||||
Inhibitor | 2-Sulfhydryl-Ethanol | Drug Info | [551391] | ||
BAICALEIN | Drug Info | [529300] | |||
CYANIDIN | Drug Info | [531133] | |||
KAEMPFEROL | Drug Info | [529300] | |||
NARINGENIN | Drug Info | [529300] | |||
PELARGONIDIN CHLORIDE | Drug Info | [531133] | |||
S-(N-4bromophenyl-N-hydroxycarbamoyl)glutathione | Drug Info | [535065] | |||
S-(N-4chlorophenyl-N-hydroxycarbamoyl)glutathione | Drug Info | [535065] | |||
S-(N-butyl-N-hydroxycarbamoyl)glutathione | Drug Info | [535065] | |||
S-(N-ethyl-N-hydroxycarbamoyl)glutathione | Drug Info | [535065] | |||
S-(N-heptyl-N-hydroxycarbamoyl)glutathione | Drug Info | [535065] | |||
S-(N-hexyl-N-hydroxycarbamoyl)glutathione | Drug Info | [535065] | |||
S-(N-Hydroxy-N-Iodophenylcarbamoyl)Glutathione | Drug Info | [551391] | |||
S-(N-methyl-N-hydroxycarbamoyl)glutathione | Drug Info | [535065] | |||
S-(N-pentyl-N-hydroxycarbamoyl)glutathione | Drug Info | [535065] | |||
S-(N-phenyl-N-hydroxycarbamoyl)glutathione | Drug Info | [535065] | |||
S-(N-propyl-N-hydroxycarbamoyl)glutathione | Drug Info | [535065] | |||
S-Benzyl-Glutathione | Drug Info | [551393] | |||
S-p-bromobenzyl glutatione | Drug Info | [530262] | |||
S-P-Nitrobenzyloxycarbonylglutathione | Drug Info | [551393] | |||
Pathways | |||||
BioCyc Pathway | Methylglyoxal degradation I | ||||
KEGG Pathway | Pyruvate metabolism | ||||
NetPath Pathway | TCR Signaling Pathway | ||||
PathWhiz Pathway | Pyruvaldehyde Degradation | ||||
Pyruvate Metabolism | |||||
Reactome | Pyruvate metabolism | ||||
References | |||||
Ref 529300 | Bioorg Med Chem. 2008 Apr 1;16(7):3969-75. Epub 2008 Jan 24.Structure-activity relationship of human GLO I inhibitory natural flavonoids and their growth inhibitory effects. | ||||
Ref 530262 | J Med Chem. 2009 Aug 13;52(15):4650-6.Inhibition of glyoxalase I: the first low-nanomolar tight-binding inhibitors. | ||||
Ref 531133 | Bioorg Med Chem. 2010 Oct 1;18(19):7029-33. Epub 2010 Aug 9.Delphinidin, a dietary anthocyanidin in berry fruits, inhibits human glyoxalase I. | ||||
Ref 535065 | Role of hydrophobic interactions in binding S-(N-aryl/alkyl-N-hydroxycarbamoyl)glutathiones to the active site of the antitumor target enzyme glyoxalase I. J Med Chem. 2000 Oct 19;43(21):3981-6. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.