Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T89360
|
||||
| Former ID |
TTDS00063
|
||||
| Target Name |
Inosine-5'-monophosphate dehydrogenase 2
|
||||
| Gene Name |
IMPDH2
|
||||
| Synonyms |
IMP dehydrogenase 2; IMPD 2; IMPDH-II; IMPDH2
|
||||
| Target Type |
Successful
|
||||
| Disease | Organ transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86] | ||||
| Pemphigus vulgaris [ICD9: 694.4; ICD10: L10.0] | |||||
| Function |
Catalyzesthe conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate- limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Could also have a single-stranded nucleic acid-binding activity and could play a role in RNA and/or DNA metabolism. It may also have a role in the development of malignancy and the growth progression of some tumors.
|
||||
| BioChemical Class |
Short-chain dehydrogenases reductases
|
||||
| Target Validation |
T89360
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.1.1.205
|
||||
| Sequence |
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 1-(3-cyano-1-methyl-1H-indol-6-yl)-3-phenylurea | Drug Info | [528041] | ||
| 1-methoxy-3-(3-(pyridin-4-yl)-1H-indol-6-yl)urea | Drug Info | [528041] | |||
| 1-methyl-1H-indole-3-carbaldehyde | Drug Info | [528040] | |||
| 1-methyl-1H-indole-3-carbonitrile | Drug Info | [528041] | |||
| 1-methyl-1H-indole-3-carboxamide | Drug Info | [528040] | |||
| 2-Benzyl-6-methoxy-5-oxazol-5-yl-1H-indole | Drug Info | [526581] | |||
| 2-methyl-3-(pyridin-4-yl)-1H-indol-6-amine | Drug Info | [528040] | |||
| 2-methyl-3-(pyridin-4-yl)-1H-indole | Drug Info | [528040] | |||
| 3-(3-cyano-1H-indol-6-yl)-1-methyl-1-phenylurea | Drug Info | [528041] | |||
| 3-(furan-3-yl)-1-methyl-1H-indole | Drug Info | [528040] | |||
| 3-(furan-3-yl)-1H-indole | Drug Info | [528040] | |||
| 3-(pyridin-4-yl)-1H-indol-6-amine | Drug Info | [528040] | |||
| 3-(pyridin-4-yl)-1H-indol-7-amine | Drug Info | [528040] | |||
| 3-(pyridin-4-yl)-1H-indole | Drug Info | [528041] | |||
| 3-(thiophen-3-yl)-1H-indol-6-amine | Drug Info | [528040] | |||
| 3-methoxy-4-(oxazol-5-yl)aniline | Drug Info | [528040] | |||
| 6-bromo-1-methyl-3-(pyridin-4-yl)-1H-indole | Drug Info | [528040] | |||
| 6-bromo-3-(pyridin-4-yl)-1H-indole | Drug Info | [528040] | |||
| 6-Chloropurine Riboside, 5'-Monophosphate | Drug Info | [551393] | |||
| 6-Methoxy-5-oxazol-5-yl-2-phenyl-1H-indole | Drug Info | [526581] | |||
| 6-phenyl-3-(pyridin-4-yl)-1H-indole | Drug Info | [528041] | |||
| C2-MAD | Drug Info | [535354] | |||
| C4-MAD | Drug Info | [535354] | |||
| Ethyl 3-(pyridin-4-yl)-1H-indole-6-carboxylate | Drug Info | [528041] | |||
| Inosinic Acid | Drug Info | [551393] | |||
| Mycophenolate mofetil | Drug Info | [551607] | |||
| Mycophenolic bis(sulfonamide) | Drug Info | [529565] | |||
| Mycophenolic hydroxamic acid | Drug Info | [531203] | |||
| N-benzyl-9-oxo-9,10-dihydroacridine-3-carboxamide | Drug Info | [528916] | |||
| Nicotinamide-Adenine-Dinucleotide | Drug Info | [551393] | |||
| Selenazole-4-Carboxyamide-Adenine Dinucleotide | Drug Info | [551393] | |||
| Tiazofurin adenine dinucleotide | Drug Info | [529172] | |||
| Pathways | |||||
| BioCyc Pathway | Purine nucleotides degradation | ||||
| Urate biosynthesis/inosine 5' | |||||
| -phosphate degradation | |||||
| Guanosine nucleotides de novo biosynthesis | |||||
| Superpathway of purine nucleotide salvage | |||||
| Purine nucleotides de novo biosynthesis | |||||
| Guanosine ribonucleotides de novo biosynthesis | |||||
| KEGG Pathway | Purine metabolism | ||||
| Drug metabolism - other enzymes | |||||
| Metabolic pathways | |||||
| PANTHER Pathway | De novo purine biosynthesis | ||||
| Reactome | Purine ribonucleoside monophosphate biosynthesis | ||||
| References | |||||
| Ref 526581 | Bioorg Med Chem Lett. 2003 Apr 7;13(7):1273-6.Novel indole-based inhibitors of IMPDH: introduction of hydrogen bond acceptors at indole C-3. | ||||
| Ref 528040 | Bioorg Med Chem Lett. 2006 May 1;16(9):2535-8. Epub 2006 Feb 17.Low molecular weight indole fragments as IMPDH inhibitors. | ||||
| Ref 528041 | Bioorg Med Chem Lett. 2006 May 1;16(9):2539-42. Epub 2006 Feb 17.Novel indole inhibitors of IMPDH from fragments: synthesis and initial structure-activity relationships. | ||||
| Ref 528916 | J Med Chem. 2007 Jul 26;50(15):3730-42. Epub 2007 Jun 22.Acridone-based inhibitors of inosine 5'-monophosphate dehydrogenase: discovery and SAR leading to the identification of N-(2-(6-(4-ethylpiperazin-1-yl)pyridin-3-yl)propan-2-yl)-2- fluoro-9-oxo-9,10-dihydroacridine-3-carboxamide (BMS-566419). | ||||
| Ref 529172 | J Med Chem. 2007 Dec 27;50(26):6685-91. Epub 2007 Nov 27.Dual inhibitors of inosine monophosphate dehydrogenase and histone deacetylases for cancer treatment. | ||||
| Ref 529565 | Bioorg Med Chem. 2008 Aug 1;16(15):7462-9. Epub 2008 Jun 10.Bis(sulfonamide) isosters of mycophenolic adenine dinucleotide analogues: inhibition of inosine monophosphate dehydrogenase. | ||||
| Ref 531203 | Bioorg Med Chem. 2010 Nov 15;18(22):8106-11. Epub 2010 Sep 18.Structure-activity relationships for inhibition of inosine monophosphate dehydrogenase and differentiation induction of K562 cells amongthe mycophenolic acid derivatives. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

