Resistance mutation info of target
| Target General Information | |||||
|---|---|---|---|---|---|
| Target ID | T57700 | ||||
| Target Name | Mast/stem cell growth factor receptor Kit (KIT) | Target Info | |||
| Gene Name | KIT | ||||
| Species | Homo sapiens | ||||
| Uniprot ID | KIT_HUMAN | ||||
| Sequence | MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV GSTASSSQPLLVHDDV [Homo sapiens] |
||||
| Drug Resistance Mutation and Corresponding Drugs | |||||
| Mutation Info | Deletion: D579 | ||||
| Mutation Info | Missense: A829P | ||||
| Mutation Info | Missense: C809G | ||||
| Mutation Info | Missense: D716N | ||||
| Mutation Info | Missense: D816A | ||||
| Mutation Info | Missense: D816E | ||||
| Mutation Info | Missense: D816G | ||||
| Mutation Info | Missense: D816H | ||||
| Mutation Info | Missense: D820A | ||||
| Mutation Info | Missense: D820E | ||||
| Mutation Info | Missense: D820G | ||||
| Mutation Info | Missense: D820Y | ||||
| Mutation Info | Missense: H697Y | ||||
| Mutation Info | Missense: K642E | ||||
| Mutation Info | Missense: N680K | ||||
| Mutation Info | Missense: N822K | ||||
| Mutation Info | Missense: N822Y | ||||
| Mutation Info | Missense: S709F | ||||
| Mutation Info | Missense: S821F | ||||
| Mutation Info | Missense: T670E | ||||
| Mutation Info | Missense: T670I | ||||
| Mutation Info | Missense: V559I | ||||
| Mutation Info | Missense: V654A | ||||
| Mutation Info | Missense: Y578C | ||||
| Mutation Info | Missense: Y823D | ||||
| Reference | |||||
| Ref 555557 | Mechanisms of resistance to imatinib mesylate in gastrointestinal stromal tumors and activity of the PKC412 inhibitor against imatinib-resistant mutants. Gastroenterology. 2005 Feb;128(2):270-9. | ||||
| Ref 555590 | Polyclonal evolution of multiple secondary KIT mutations in gastrointestinal stromal tumors under treatment with imatinib mesylate. Clin Cancer Res. 2006 Mar 15;12(6):1743-9. | ||||
| Ref 555607 | Molecular correlates of imatinib resistance in gastrointestinal stromal tumors. J Clin Oncol. 2006 Oct 10;24(29):4764-74. Epub 2006 Sep 5. | ||||
| Ref 555625 | Juxtamembrane-type c-kit gene mutation found in aggressive systemic mastocytosis induces imatinib-resistant constitutive KIT activation. Lab Invest. 2007 Apr;87(4):365-71. Epub 2007 Jan 29. | ||||
| Ref 555643 | Clonal evolution of resistance to imatinib in patients with metastatic gastrointestinal stromal tumors. Clin Cancer Res. 2007 Sep 15;13(18 Pt 1):5398-405. | ||||
| Ref 555661 | Surgical intervention following imatinib treatment in patients with advanced gastrointestinal stromal tumors (GISTs). J Surg Oncol. 2008 Jul 1;98(1):27-33. doi: 10.1002/jso.21065. | ||||
| Ref 555672 | Heterogeneity of kinase inhibitor resistance mechanisms in GIST. J Pathol. 2008 Sep;216(1):64-74. doi: 10.1002/path.2382. | ||||
| Ref 555685 | Primary and secondary kinase genotypes correlate with the biological and clinical activity of sunitinib in imatinib-resistant gastrointestinal stromal tumor. J Clin Oncol. 2008 Nov 20;26(33):5352-9. doi: 10.1200/JCO.2007.15.7461. Epub 2008 Oct 27. | ||||
| Ref 555743 | Molecular mechanisms of secondary imatinib resistance in patients with gastrointestinal stromal tumors. J Cancer Res Clin Oncol. 2010 Jul;136(7):1065-71. doi: 10.1007/s00432-009-0753-7. Epub 2009 Dec 31. | ||||
| Ref 555799 | Surgical intervention for imatinib and sunitinib-resistant gastrointestinal stromal tumors. Int J Clin Oncol. 2011 Dec;16(6):741-5. doi: 10.1007/s10147-011-0208-4. Epub 2011 Mar 12. | ||||
| Ref 555811 | Novel, activating KIT-N822I mutation in familial cutaneous mastocytosis. Exp Hematol. 2011 Aug;39(8):859-65.e2. doi: 10.1016/j.exphem.2011.05.009. Epub 2011 May 27. | ||||
| Ref 555938 | Secondary c-Kit mutations confer acquired resistance to RTK inhibitors in c-Kit mutant melanoma cells. Pigment Cell Melanoma Res. 2013 Jul;26(4):518-26. doi: 10.1111/pcmr.12107. Epub 2013 May 13. | ||||
| Ref 532541 | Flumatinib, a selective inhibitor of BCR-ABL/PDGFR/KIT, effectively overcomes drug resistance of certain KIT mutants. Cancer Sci. 2014 Jan;105(1):117-25. | ||||
| Ref 556051 | Detection of KIT and PDGFRA mutations in the plasma of patients with gastrointestinal stromal tumor. Target Oncol. 2015 Dec;10(4):597-601. doi: 10.1007/s11523-015-0361-1. Epub 2015 Mar 5. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

