Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T82577
|
||||
| Former ID |
TTDS00181
|
||||
| Target Name |
Angiotensin-converting enzyme
|
||||
| Gene Name |
ACE
|
||||
| Synonyms |
CD143 antigen; Dipeptidyl carboxypeptidase I; Kininase II; ACE
|
||||
| Target Type |
Successful
|
||||
| Disease | Congestive heart failure [ICD9: 428; ICD10: I50] | ||||
| Congestive heart failure; Hypertension [ICD9: 428; ICD10: I50] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
| Hypotension [ICD9: 458, 796.3; ICD10: I95] | |||||
| Hypertension; Renal failure; Heart failure; Diabetic nephropathy [ICD9: 250, 401, 428, 580-599, 584, 585; ICD10: E08-E13, I10-I16, I50, N00-N29, N17, N18, N19] | |||||
| Luid retention [ICD9: 782.3; ICD10: R60.9] | |||||
| Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety.
|
||||
| BioChemical Class |
Glycosylases
|
||||
| Target Validation |
T82577
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.15.1
|
||||
| Sequence |
MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQV
LFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPQLRRI IGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSR SYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDL EHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPF PDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCH ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAI GDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS GRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF HEALCKEAGYEGPLHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLL KYFQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKFVEEYDRTS QVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRI IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKY EDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLER LFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS APSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHAS AWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGD VLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGS ITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHE ALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSY FKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQW LLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS |
||||
| Structure |
1O86; 1O8A; 1UZE; 1UZF; 2C6F; 2C6N; 2IUL; 2IUX; 2OC2; 2XY9; 2XYD; 2YDM; 3BKK; 3BKL; 3L3N; 3NXQ; 4APH; 4APJ; 4BXK; 4BZR; 4BZS; 4C2N; 4C2O; 4C2P; 4C2Q; 4C2R; 4CA5; 4CA6
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Alacepril | Drug Info | Approved | Cardiovascular disorder | [551871] |
| Benazepril | Drug Info | Approved | Hypertension | [536361], [541514] | |
| Captopril | Drug Info | Approved | Hypertension | [468221], [538272] | |
| Cilazapril | Drug Info | Approved | Congestive heart failure | [536361], [541597] | |
| Delapril | Drug Info | Approved | Cardiovascular disorder | [536361] | |
| Deserpidine | Drug Info | Approved | Hypertension | [538438], [542070] | |
| Enalapril | Drug Info | Approved | Hypertension | [536095], [541468] | |
| Enalaprilat | Drug Info | Approved | Hypertension | [536361], [541478] | |
| Fosinopril | Drug Info | Approved | Hypertension | [536361], [541595] | |
| Hydrochlorothiazide | Drug Info | Approved | Luid retention | [468069], [538179] | |
| Imidapril hci | Drug Info | Approved | Cardiovascular disorder | [551871] | |
| Lisinopril | Drug Info | Approved | Hypertension | [536361], [541501] | |
| Moexipril | Drug Info | Approved | Hypertension | [536361], [541695] | |
| Perindopril | Drug Info | Approved | Hypertension | [536361], [541508] | |
| Quinapril | Drug Info | Approved | Hypertension | [536361], [541494] | |
| Ramipril | Drug Info | Approved | Congestive heart failure; Hypertension | [536186], [541484] | |
| Rescinnamine | Drug Info | Approved | Hypertension | [538435], [542104] | |
| Spirapril | Drug Info | Approved | Hypertension | [536361], [541698] | |
| Temocapril hydrochloride | Drug Info | Approved | Cardiovascular disorder | [551871] | |
| Trandolapril | Drug Info | Approved | Hypertension | [536095], [541594] | |
| GW-796406 | Drug Info | Phase 1 | Hypotension | [527730] | |
| Ilepatril | Drug Info | Discontinued in Phase 2/3 | Hypertension; Renal failure; Heart failure; Diabetic nephropathy | [536642] | |
| Ceronapril | Drug Info | Discontinued in Phase 2 | Major depressive disorder | [544627] | |
| Idrapril | Drug Info | Discontinued in Phase 2 | Hypertension | [545074] | |
| M-100240 | Drug Info | Discontinued in Phase 2 | Hypotension | [545322] | |
| METIAPRIL | Drug Info | Discontinued in Phase 2 | Hypotension | [545860] | |
| UTIBAPRIL | Drug Info | Discontinued in Phase 2 | Hypertension | [544639] | |
| Zabiciprilat | Drug Info | Discontinued in Phase 2 | Hypertension | [544560] | |
| GSK 796406 | Drug Info | Discontinued in Phase 1 | Hypertension | [549953] | |
| BMS-182657 | Drug Info | Terminated | Cardiovascular disorder | [533583] | |
| CGS-30440 | Drug Info | Terminated | Hypertension | [534574] | |
| DU-1777 | Drug Info | Terminated | Hypertension | [545072] | |
| GW-660511 | Drug Info | Terminated | Hypertension | [525698] | |
| NO-antihypertensives | Drug Info | Terminated | Hypertension | [546899] | |
| Omapatrilat | Drug Info | Terminated | Hypertension | [526007] | |
| SCH-54470 | Drug Info | Terminated | Discovery agent | [546391] | |
| SQ-26332 | Drug Info | Terminated | Discovery agent | [544625] | |
| Inhibitor | 2-(Acetylamino)-2-Deoxy-a-D-Glucopyranose | Drug Info | [551393] | ||
| Acetate Ion | Drug Info | [551393] | |||
| ASTRAGALIN | Drug Info | [551347] | |||
| Benazepril | Drug Info | [535660], [537572] | |||
| BUTEIN | Drug Info | [530737] | |||
| Captopril | Drug Info | [535533] | |||
| Ceronapril | Drug Info | [526817] | |||
| Cilazapril | Drug Info | [536694] | |||
| CONTIGOSIDE B | Drug Info | [551347] | |||
| Deserpidine | Drug Info | [535714], [537758] | |||
| DU-1777 | Drug Info | [533641] | |||
| Enalapril | Drug Info | [537534] | |||
| Enalaprilat | Drug Info | [535379] | |||
| fasidotrilat | Drug Info | [528270] | |||
| Fosinopril | Drug Info | [537042] | |||
| GSK 796406 | Drug Info | [549997] | |||
| Idrapril | Drug Info | [526807] | |||
| Kaempferol-3-O-(2''-O-galloyl)-glucoside | Drug Info | [551347] | |||
| Lisinopril | Drug Info | [537530] | |||
| lisinopril-tryptophan | Drug Info | [530789] | |||
| LY-292223 | Drug Info | [527383] | |||
| METIAPRIL | Drug Info | [534099] | |||
| Moexipril | Drug Info | [537123] | |||
| N-Carboxymethyl-N-cyclopentyl-phthalamic acid | Drug Info | [533393] | |||
| NO-antihypertensives | Drug Info | [544048] | |||
| Perindopril | Drug Info | [537450] | |||
| Quinapril | Drug Info | [537132] | |||
| Ramipril | Drug Info | [535660] | |||
| Rescinnamine | Drug Info | [536173] | |||
| RIP | Drug Info | [533492] | |||
| RJM-0035-K002 | Drug Info | [543448] | |||
| RXP-407 | Drug Info | [531920] | |||
| SCH-54470 | Drug Info | [530505] | |||
| Spirapril | Drug Info | [536133] | |||
| SQ-26332 | Drug Info | [527799] | |||
| Trandolapril | Drug Info | [537291] | |||
| UTIBAPRIL | Drug Info | [534415] | |||
| Zabiciprilat | Drug Info | [533956] | |||
| [Cyclopentyl-(2-nitro-benzoyl)-amino]-acetic acid | Drug Info | [533393] | |||
| Modulator | Alacepril | Drug Info | [534314], [536361] | ||
| BMS-182657 | Drug Info | [533583] | |||
| BRL-36378 | Drug Info | ||||
| CGS-30440 | Drug Info | [534574] | |||
| Delapril | Drug Info | [525822], [528275], [534314], [536361] | |||
| GW-660511 | Drug Info | [525698] | |||
| GW-796406 | Drug Info | [549997] | |||
| Hydrochlorothiazide | Drug Info | [556264] | |||
| Ilepatril | Drug Info | [536642] | |||
| Imidapril hci | Drug Info | [534314], [536361] | |||
| M-100240 | Drug Info | ||||
| moexiprilat | Drug Info | [553173] | |||
| Omapatrilat | Drug Info | [526007] | |||
| RB-105 | Drug Info | ||||
| Temocapril hydrochloride | Drug Info | [534314], [536361] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Renin-angiotensin system | ||||
| Chagas disease (American trypanosomiasis) | |||||
| Hypertrophic cardiomyopathy (HCM) | |||||
| PathWhiz Pathway | Angiotensin Metabolism | ||||
| Reactome | Metabolism of Angiotensinogen to Angiotensins | ||||
| WikiPathways | ACE Inhibitor Pathway | ||||
| Metabolism of Angiotensinogen to Angiotensins | |||||
| References | |||||
| Ref 468069 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4836). | ||||
| Ref 468221 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5158). | ||||
| Ref 525698 | The effects of Z13752A, a combined ACE/NEP inhibitor, on responses to coronary artery occlusion; a primary protective role for bradykinin. Br J Pharmacol. 2000 Feb;129(4):671-80. | ||||
| Ref 526007 | Omapatrilat, a dual angiotensin-converting enzyme and neutral endopeptidase inhibitor, prevents fatty streak deposit in apolipoprotein E-deficient mice. Atherosclerosis. 2001 Apr;155(2):291-5. | ||||
| Ref 527730 | Mechanism of vasopeptidase inhibitor-induced plasma extravasation: comparison of omapatrilat and the novel neutral endopeptidase 24.11/angiotensin-converting enzyme inhibitor GW796406. J Pharmacol Exp Ther. 2005 Dec;315(3):1306-13. Epub 2005 Sep 6. | ||||
| Ref 533583 | Cardiovascular effects of the novel dual inhibitor of neutral endopeptidase and angiotensin-converting enzyme BMS-182657 in experimental hypertension and heart failure. J Pharmacol Exp Ther. 1995 Nov;275(2):745-52. | ||||
| Ref 534574 | Antihypertensive and natriuretic effects of CGS 30440, a dual inhibitor of angiotensin-converting enzyme and neutral endopeptidase 24.11. J Pharmacol Exp Ther. 1998 Mar;284(3):974-82. | ||||
| Ref 536095 | New antiarrhythmic agents for atrial fibrillation and atrial flutter. Expert Opin Emerg Drugs. 2005 May;10(2):311-22. | ||||
| Ref 536186 | Emerging drugs in peripheral arterial disease. Expert Opin Emerg Drugs. 2006 Mar;11(1):75-90. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536642 | Ilepatril (AVE-7688), a vasopeptidase inhibitor for the treatment of hypertension. Curr Opin Investig Drugs. 2008 Mar;9(3):301-9. | ||||
| Ref 538179 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040412. | ||||
| Ref 538272 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074322. | ||||
| Ref 538435 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010686. | ||||
| Ref 538438 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010796. | ||||
| Ref 541468 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6322). | ||||
| Ref 541478 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6332). | ||||
| Ref 541484 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6339). | ||||
| Ref 541494 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6350). | ||||
| Ref 541501 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6360). | ||||
| Ref 541508 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6367). | ||||
| Ref 541514 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6374). | ||||
| Ref 541594 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6453). | ||||
| Ref 541595 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6456). | ||||
| Ref 541597 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6459). | ||||
| Ref 541695 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6571). | ||||
| Ref 541698 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6575). | ||||
| Ref 542070 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7064). | ||||
| Ref 542104 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7098). | ||||
| Ref 544560 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000139) | ||||
| Ref 544625 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000347) | ||||
| Ref 544627 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000355) | ||||
| Ref 544639 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000394) | ||||
| Ref 545072 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002041) | ||||
| Ref 545074 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002045) | ||||
| Ref 545322 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002832) | ||||
| Ref 545860 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005081) | ||||
| Ref 546391 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007872) | ||||
| Ref 546899 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010971) | ||||
| Ref 525698 | The effects of Z13752A, a combined ACE/NEP inhibitor, on responses to coronary artery occlusion; a primary protective role for bradykinin. Br J Pharmacol. 2000 Feb;129(4):671-80. | ||||
| Ref 525822 | The influence of natural products upon drug discovery. Nat Prod Rep. 2000 Jun;17(3):215-34. | ||||
| Ref 526007 | Omapatrilat, a dual angiotensin-converting enzyme and neutral endopeptidase inhibitor, prevents fatty streak deposit in apolipoprotein E-deficient mice. Atherosclerosis. 2001 Apr;155(2):291-5. | ||||
| Ref 526807 | Pharmacology of idrapril: a new class of angiotensin converting enzyme inhibitors. J Cardiovasc Pharmacol. 1992 Jul;20(1):139-46. | ||||
| Ref 526817 | Radioimmunoassay for ceronapril, a new angiotensin-converting enzyme inhibitor, and its application to a pharmacokinetic study in healthy male volunteers. Ther Drug Monit. 1992 Jun;14(3):209-19. | ||||
| Ref 527383 | J Med Chem. 2005 Jan 27;48(2):483-98.Endothelin-converting enzyme-1 inhibition and growth of human glioblastoma cells. | ||||
| Ref 527799 | J Med Chem. 2005 Oct 20;48(21):6523-43.Designed multiple ligands. An emerging drug discovery paradigm. | ||||
| Ref 530505 | J Med Chem. 2010 Jan 14;53(1):208-20.Phosphinic tripeptides as dual angiotensin-converting enzyme C-domain and endothelin-converting enzyme-1 inhibitors. | ||||
| Ref 530737 | Bioorg Med Chem Lett. 2010 Mar 15;20(6):1990-3. Epub 2010 Jan 25.The synthesis and angiotensin converting enzyme (ACE) inhibitory activity of chalcones and their pyrazole derivatives. | ||||
| Ref 530789 | Characterization of domain-selective inhibitor binding in angiotensin-converting enzyme using a novel derivative of lisinopril. Biochem J. 2010 Apr 28;428(1):67-74. | ||||
| Ref 531920 | New ketomethylene inhibitor analogues: synthesis and assessment of structural determinants for N-domain selective inhibition of angiotensin-converting enzyme. Biol Chem. 2012 May;393(6):485-93. | ||||
| Ref 533393 | J Med Chem. 1985 Mar;28(3):328-32.Angiotensin converting enzyme inhibitors. (Mercaptoaroyl)amino acids. | ||||
| Ref 533492 | J Med Chem. 1985 Nov;28(11):1553-5.Difluorostatine- and difluorostatone-containing peptides as potent and specific renin inhibitors. | ||||
| Ref 533583 | Cardiovascular effects of the novel dual inhibitor of neutral endopeptidase and angiotensin-converting enzyme BMS-182657 in experimental hypertension and heart failure. J Pharmacol Exp Ther. 1995 Nov;275(2):745-52. | ||||
| Ref 533641 | Antihypertensive properties of a new long-acting angiotensin converting enzyme inhibitor in renin-dependent and independent hypertensive models. Arzneimittelforschung. 1995 Aug;45(8):853-8. | ||||
| Ref 533956 | Enzyme immunoassays for a new angiotensin-converting enzyme inhibitor, zabicipril, and its active metabolite in human plasma: application to pharmacokinetic studies. Ther Drug Monit. 1993 Oct;15(5):448-54. | ||||
| Ref 534099 | The clinical efficacy of the first Russian angiotensin-converting enzyme inhibitor methiopril in patients with heart failure. Klin Med (Mosk). 1995;73(3):49-51. | ||||
| Ref 534415 | Differential inhibition of plasma versus tissue ACE by utibapril: biochemical and functional evidence for inhibition of vascular ACE activity. J Cardiovasc Pharmacol. 1997 May;29(5):684-91. | ||||
| Ref 534574 | Antihypertensive and natriuretic effects of CGS 30440, a dual inhibitor of angiotensin-converting enzyme and neutral endopeptidase 24.11. J Pharmacol Exp Ther. 1998 Mar;284(3):974-82. | ||||
| Ref 535379 | Analysis of Vancomycin in the Hindlimb Vascular Bed of the Rat. Am J Ther. 1996 Oct;3(10):681-687. | ||||
| Ref 535660 | Knockouts model the 100 best-selling drugs--will they model the next 100? Nat Rev Drug Discov. 2003 Jan;2(1):38-51. | ||||
| Ref 535714 | Angiotensin II-induced modulation of endothelium-dependent relaxation in rabbit mesenteric resistance arteries. J Physiol. 2003 May 1;548(Pt 3):893-906. Epub 2003 Mar 21. | ||||
| Ref 536133 | Central angiotensin II controls alcohol consumption via its AT1 receptor. FASEB J. 2005 Sep;19(11):1474-81. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536642 | Ilepatril (AVE-7688), a vasopeptidase inhibitor for the treatment of hypertension. Curr Opin Investig Drugs. 2008 Mar;9(3):301-9. | ||||
| Ref 536694 | Triple pharmacological blockade of the renin-angiotensin-aldosterone system in nondiabetic CKD: an open-label crossover randomized controlled trial. Am J Kidney Dis. 2008 Sep;52(3):486-93. Epub 2008Apr 18. | ||||
| Ref 537042 | Angiotensin-converting enzyme inhibition and novel cardiovascular risk biomarkers: results from the Trial of Angiotensin Converting Enzyme Inhibition and Novel Cardiovascular Risk Factors (TRAIN) study. Am Heart J. 2009 Feb;157(2):334.e1-8. | ||||
| Ref 537123 | Moexipril for Treatment of Primary Biliary Cirrhosis in Patients with an Incomplete Response to Ursodeoxycholic Acid. Dig Dis Sci. 2009 Mar 3. | ||||
| Ref 537132 | An experimental model of encapsulating peritoneal sclerosis. Perit Dial Int. 2009 Feb;29 Suppl 2:S49-50. | ||||
| Ref 537291 | Selective reduction of central pulse pressure under angiotensin blockage in SHR: role of the fibronectin-alpha5beta1 integrin complex. Am J Hypertens. 2009 Jul;22(7):711-7. Epub 2009 May 7. | ||||
| Ref 537450 | Fixed combination perindopril-amlodipine (Coveram) in the treatment of hypertension and coronary heart disease. Rev Med Liege. 2009 Apr;64(4):223-7. | ||||
| Ref 537530 | Involvement of vascular angiotensin II-forming enzymes in the progression of aortic abdominal aneurysms in angiotensin II- infused ApoE-deficient mice. J Atheroscler Thromb. 2009 Jun;16(3):164-71. Epub 2009 Jun 25. | ||||
| Ref 537534 | Determination of bezafibrate, methotrexate, cyclophosphamide, orlistat and enalapril in waste and surface waters using on-line solid-phase extraction liquid chromatography coupled to polarity-switching electrospray tandem mass spectrometry. J Environ Monit. 2009 Apr;11(4):830-8. Epub 2009 Jan 21. | ||||
| Ref 537572 | Efficacy of Benazepril Hydrochloride to Delay the Progression of Occult Dilated Cardiomyopathy in Doberman Pinschers. J Vet Intern Med. 2009 Jul 1. | ||||
| Ref 537758 | Drug interaction exposures in an ambulatory Medicaid population. Am J Hosp Pharm. 1979 Jul;36(7):923-7. | ||||
| Ref 543448 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1613). | ||||
| Ref 544048 | Molecular determinants of cAMP-mediated regulation of the Na+-Ca2+ exchanger expressed in human cell lines. J Physiol. 2003 May 1; 548(Pt 3): 677-689. | ||||
| Ref 549997 | Mechanism of vasopeptidase inhibitor-induced plasma extravasation: comparison of omapatrilat and the novel neutral endopeptidase 24.11/angiotensin-converting enzyme inhibitor GW796406. J Pharmacol Exp Ther. 2005 Dec;315(3):1306-13. | ||||
| Ref 551347 | Inhibitory effects of various flavonoids isolated from leaves of persimmon on angiotensin-converting enzyme activity. J Nat Prod. 1987 Jul-Aug;50(4):680-3. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

