Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T37848
|
||||
| Former ID |
TTDS00418
|
||||
| Target Name |
Cytochrome P450 3A4
|
||||
| Gene Name |
CYP3A4
|
||||
| Synonyms |
Albendazole monooxygenase; Albendazole sulfoxidase; CYP3A3; CYPIIIA3; CYPIIIA4; Cytochrome P450 3A3; HLp; NF-25; Nifedipine oxidase; P450-PCN1; Quinine 3-monooxygenase; Taurochenodeoxycholate 6-alpha-hydroxylase; CYP3A4
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Function |
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e.g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1'-hydroxylation and midazolam 4- hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,8-cineole 2- exo-monooxygenase. The enzyme also hydroxylates etoposide.
|
||||
| BioChemical Class |
Oxidoreductases acting on paired donors
|
||||
| Target Validation |
T37848
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.14.13.97
|
||||
| Sequence |
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMF
DMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG GLLQPEKPVVLKVESRDGTVSGA |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | (-)-clusin | Drug Info | [527404] | ||
| (-)-cubebin | Drug Info | [527404] | |||
| (-)-cubebinin | Drug Info | [527404] | |||
| (-)-cubebininolide | Drug Info | [527404] | |||
| (-)-dihydroclusin | Drug Info | [527404] | |||
| (-)-thujaplicatintrimethyl ether | Drug Info | [527404] | |||
| (-)-yatein | Drug Info | [527404] | |||
| (5-pyridin-3-yl-furan-2-yl)methanethiol | Drug Info | [528540] | |||
| (8R,8'R)-4-hydroxycubebinone | Drug Info | [527404] | |||
| (8R,8'R,9'S)-5-methoxyclusin | Drug Info | [527404] | |||
| 1,1':4',1''-terphenyl-3,3''-diol | Drug Info | [529748] | |||
| 1,2-Diacetoxylycorine | Drug Info | [530120] | |||
| 1-(3,4-DICHLOROPHENYL)-6-(METHOXYMETHYL)-3-AZABICYCLO[4.1.0]HEPTANE (ENANTIOMERIC MIX) | Drug Info | [530957] | |||
| 1-(4-Butoxy-phenyl)-1H-imidazole | Drug Info | [526913] | |||
| 1-(METHOXYMETHYL)-6-(NAPHTHALEN-2-YL)-3-AZABICYCLO[4.1.0]HEPTANE (ENANTIOMERIC MIX) | Drug Info | [530957] | |||
| 1-Acetoxy-2-tert-butyldimethylsilyl-oxylycorine | Drug Info | [530120] | |||
| 1-Acetoxylycorine | Drug Info | [530120] | |||
| 1H-1,2,3-benzotriazol-1-amine | Drug Info | [526196] | |||
| 2,5-bis(4-hydroxybenzylidene)cyclopentanone | Drug Info | [529286] | |||
| 2-(2-(4-tert-Butylphenylthio)ethyl)-1H-imidazole | Drug Info | [530846] | |||
| 2-(4-Imidazol-1-yl-phenoxymethyl)-pyridine | Drug Info | [526913] | |||
| 2-Fluoro-4-[5-(3-hydroxyphenyl)-2-thienyl]phenol | Drug Info | [530450] | |||
| 2-fluoro-5-(3-methylthiophen-2-yl)pyridine | Drug Info | [528540] | |||
| 2-tert-Butyldimethylsilyloxylycorine | Drug Info | [530120] | |||
| 2-[3-(4-Imidazol-1-yl-phenoxy)-propyl]-pyridine | Drug Info | [526913] | |||
| 3,3-(1,3-Thiazole-2,5-diyl)diphenol | Drug Info | [529748] | |||
| 3-(3-methylthiophen-2-yl)pyridine | Drug Info | [528540] | |||
| 3-(5-((methylthio)methyl)furan-2-yl)pyridine | Drug Info | [528540] | |||
| 3-(5-[1,3]dithiolan-2-yl-furan-2-yl)pyridine | Drug Info | [528540] | |||
| 3-(pyridin-3-yl)prop-2-yn-1-amine | Drug Info | [528540] | |||
| 3-methoxy-5-(6-methoxynaphthalen-2-yl)pyridine | Drug Info | [529624] | |||
| 3-[3-(4-Imidazol-1-yl-phenoxy)-propyl]-pyridine | Drug Info | [526913] | |||
| 3-[3-(4-Methoxybenzyl)naphthalen-2-yl]pyridine | Drug Info | [529667] | |||
| 3-[5-(4-Hydroxyphenyl)-3-thienyl]phenol | Drug Info | [529748] | |||
| 4-(6-Methoxynaphthalen-2-yl)isoquinoline | Drug Info | [529624] | |||
| 4-[2-(4-Imidazol-1-yl-phenoxy)-ethyl]-morpholine | Drug Info | [526913] | |||
| 4-[3-(4-Imidazol-1-yl-phenoxy)-propyl]-pyridine | Drug Info | [526913] | |||
| 4-[5-(3-Hydroxyphenyl)-2-thienyl)-2-methyl]phenol | Drug Info | [530450] | |||
| 4-[5-(3-Hydroxyphenyl)-3-thienyl]-2-methylphenol | Drug Info | [530450] | |||
| 5-(2-phenethylpiperazin-1-yl)-1H-indazole | Drug Info | [551240] | |||
| 5-Pyridin-3-yl-thiophene-2-carbaldehyde oxime | Drug Info | [527367] | |||
| 6-(3,4-DICHLOROPHENYL)-1-[1-(METHYLOXY)-3-BUTEN-1-YL]-3-AZABICYCLO[4.1.0]HEPTANE (DIASTEREOMERIC MIX) | Drug Info | [530957] | |||
| 6-(3-Hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [529359] | |||
| 6-Pyridin-3-yl-3,4-dihydronaphthalen-2(1H)-one | Drug Info | [529834] | |||
| Ac-Phe-[Orn-Pro-cha-Trp-Arg] | Drug Info | [528343] | |||
| Alpha-Hydroxy-Midazolam | Drug Info | [526846] | |||
| Alpha-methylcubebin | Drug Info | [527404] | |||
| BERGAPTOL | Drug Info | [528768] | |||
| BMS-536924 | Drug Info | [529668] | |||
| Curcumin | Drug Info | [529286] | |||
| DIETHOXYFLOURESCEIN | Drug Info | [531159] | |||
| DIHYDROCUBEBIN | Drug Info | [527404] | |||
| ETHOXYCLUSIN | Drug Info | [527404] | |||
| Geranylcoumarin | Drug Info | [528768] | |||
| Go-Y026 | Drug Info | [529286] | |||
| GSK-8062 | Drug Info | [529591] | |||
| Heme | Drug Info | [551374] | |||
| HINOKININ | Drug Info | [527404] | |||
| JATRORRHIZINE | Drug Info | [529147] | |||
| MEDIORESINOL | Drug Info | [527404] | |||
| Methyl-(5-pyridin-3-yl-thiophen-2-yl)-amine | Drug Info | [527367] | |||
| ML-3163 | Drug Info | [526668] | |||
| ML-3375 | Drug Info | [526668] | |||
| ML-3403 | Drug Info | [526668] | |||
| PALMATINE | Drug Info | [529147] | |||
| TILIROSIDE | Drug Info | [527311] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Steroid hormone biosynthesis | ||||
| Linoleic acid metabolism | |||||
| Retinol metabolism | |||||
| Metabolism of xenobiotics by cytochrome P450 | |||||
| Drug metabolism - cytochrome P450 | |||||
| Drug metabolism - other enzymes | |||||
| Metabolic pathways | |||||
| Bile secretion | |||||
| Chemical carcinogenesis | |||||
| PathWhiz Pathway | Caffeine Metabolism | ||||
| Retinol Metabolism | |||||
| Reactome | Xenobiotics | ||||
| Aflatoxin activation and detoxification | |||||
| WikiPathways | Metapathway biotransformation | ||||
| Aflatoxin B1 metabolism | |||||
| Estrogen metabolism | |||||
| Benzo(a)pyrene metabolism | |||||
| Tamoxifen metabolism | |||||
| Tryptophan metabolism | |||||
| Oxidation by Cytochrome P450 | |||||
| Nuclear Receptors in Lipid Metabolism and Toxicity | |||||
| Nuclear Receptors Meta-Pathway | |||||
| Farnesoid X Receptor Pathway | |||||
| Vitamin D Receptor Pathway | |||||
| Felbamate Metabolism | |||||
| Lidocaine metabolism | |||||
| Nifedipine Activity | |||||
| Colchicine Metabolic Pathway | |||||
| Irinotecan Pathway | |||||
| Drug Induction of Bile Acid Pathway | |||||
| Fatty Acid Omega Oxidation | |||||
| Codeine and Morphine Metabolism | |||||
| References | |||||
| Ref 526196 | Bioorg Med Chem Lett. 2001 Dec 3;11(23):2993-5.Discovery of a N'-hydroxyphenylformamidine derivative HET0016 as a potent and selective 20-HETE synthase inhibitor. | ||||
| Ref 526668 | J Med Chem. 2003 Jul 17;46(15):3230-44.Novel substituted pyridinyl imidazoles as potent anticytokine agents with low activity against hepatic cytochrome P450 enzymes. | ||||
| Ref 526846 | Bioorg Med Chem Lett. 2003 Nov 3;13(21):3643-5.Design and synthesis of a new fluorescent probe for cytochrome P450 3A4 (CYP 3A4). | ||||
| Ref 526913 | Bioorg Med Chem Lett. 2004 Jan 19;14(2):333-6.Imidazole derivatives as new potent and selective 20-HETE synthase inhibitors. | ||||
| Ref 527311 | J Nat Prod. 2004 Nov;67(11):1839-41.Isolation of cytochrome P450 inhibitors from strawberry fruit, Fragaria ananassa. | ||||
| Ref 527367 | J Med Chem. 2005 Jan 13;48(1):224-39.5-substituted, 6-substituted, and unsubstituted 3-heteroaromatic pyridine analogues of nicotine as selective inhibitors of cytochrome P-450 2A6. | ||||
| Ref 528343 | Bioorg Med Chem Lett. 2006 Oct 1;16(19):5088-92. Epub 2006 Jul 28.Peptidomimetic C5a receptor antagonists with hydrophobic substitutions at the C-terminus: increased receptor specificity and in vivoactivity. | ||||
| Ref 528540 | J Med Chem. 2006 Nov 30;49(24):6987-7001.Synthetic inhibitors of cytochrome P-450 2A6: inhibitory activity, difference spectra, mechanism of inhibition, and protein cocrystallization. | ||||
| Ref 528768 | Bioorg Med Chem. 2007 Jun 1;15(11):3684-91. Epub 2007 Mar 18.Radical scavenging and cytochrome P450 3A4 inhibitory activity of bergaptol and geranylcoumarin from grapefruit. | ||||
| Ref 529147 | J Nat Prod. 2007 Dec;70(12):1930-3. Epub 2007 Nov 10.Cytochrome P3A4 inhibitors and other constituents of Fibraurea tinctoria. | ||||
| Ref 529286 | Eur J Med Chem. 2008 Aug;43(8):1621-31. Epub 2007 Nov 17.Structure-activity relationships for the inhibition of recombinant human cytochromes P450 by curcumin analogues. | ||||
| Ref 529359 | J Med Chem. 2008 Apr 10;51(7):2158-69. Epub 2008 Mar 7.Design, synthesis, and biological evaluation of (hydroxyphenyl)naphthalene and -quinoline derivatives: potent and selective nonsteroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1) for the treatment of estrogen-dependent diseases. | ||||
| Ref 529591 | Bioorg Med Chem Lett. 2008 Aug 1;18(15):4339-43. Epub 2008 Jun 28.Conformationally constrained farnesoid X receptor (FXR) agonists: Naphthoic acid-based analogs of GW 4064. | ||||
| Ref 529624 | J Med Chem. 2008 Aug 28;51(16):5064-74. Epub 2008 Aug 1.Overcoming undesirable CYP1A2 inhibition of pyridylnaphthalene-type aldosterone synthase inhibitors: influence of heteroaryl derivatization onpotency and selectivity. | ||||
| Ref 529667 | J Med Chem. 2008 Oct 9;51(19):6138-49. Epub 2008 Sep 3.Novel aldosterone synthase inhibitors with extended carbocyclic skeleton by a combined ligand-based and structure-based drug design approach. | ||||
| Ref 529668 | J Med Chem. 2008 Oct 9;51(19):5897-900. Epub 2008 Sep 3.Discovery and evaluation of 4-(2-(4-chloro-1H-pyrazol-1-yl)ethylamino)-3-(6-(1-(3-fluoropropyl)piperidin-4-yl)-4-methyl-1H-benzo[d]imidazol-2-yl)pyridin-2(1H)-one (BMS-695735), an orally efficacious inhibitor of insulin-like growth factor-1 receptor kinase with broad spectrum in vivo antitumor activity. | ||||
| Ref 529748 | J Med Chem. 2008 Nov 13;51(21):6725-39. Epub 2008 Oct 15.Design, synthesis, biological evaluation and pharmacokinetics of bis(hydroxyphenyl) substituted azoles, thiophenes, benzenes, and aza-benzenes as potent and selective nonsteroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1). | ||||
| Ref 529834 | J Med Chem. 2008 Dec 25;51(24):8077-87.In vivo active aldosterone synthase inhibitors with improved selectivity: lead optimization providing a series of pyridine substituted 3,4-dihydro-1H-quinolin-2-one derivatives. | ||||
| Ref 530120 | Bioorg Med Chem Lett. 2009 Jun 15;19(12):3233-7. Epub 2009 Apr 24.Selective cytochrome P450 3A4 inhibitory activity of Amaryllidaceae alkaloids. | ||||
| Ref 530450 | J Med Chem. 2009 Nov 12;52(21):6724-43.New insights into the SAR and binding modes of bis(hydroxyphenyl)thiophenes and -benzenes: influence of additional substituents on 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1) inhibitory activity and selectivity. | ||||
| Ref 530846 | J Med Chem. 2010 May 13;53(9):3840-4.Role of hydrophobic substituents on the terminal nitrogen of histamine in receptor binding and agonist activity: development of an orally active histamine type 3 receptor agonist and evaluation of its antistress activity in mice. | ||||
| Ref 530957 | J Med Chem. 2010 Jul 8;53(13):4989-5001.6-(3,4-dichlorophenyl)-1-[(methyloxy)methyl]-3-azabicyclo[4.1.0]heptane: a new potent and selective triple reuptake inhibitor. | ||||
| Ref 531159 | J Med Chem. 2010 Oct 14;53(19):7129-39.Exploration of the amine terminus in a novel series of 1,2,4-triazolo-3-yl-azabicyclo[3.1.0]hexanes as selective dopamine D3 receptor antagonists. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

