Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T72168
|
||||
Former ID |
TTDS00206
|
||||
Target Name |
Mineralocorticoid receptor
|
||||
Gene Name |
NR3C2
|
||||
Synonyms |
Delta; Inner ear mineralocorticoid receptor; MR; NR3C2
|
||||
Target Type |
Successful
|
||||
Disease | Addison's disease [ICD9: 255.4; ICD10: E27.1-E27.2] | ||||
Chronic kidney disease [ICD9: 403, 585.1-585.5, 585.9; ICD10: N18] | |||||
Cerebral salt-wasting syndrome [ICD10: E87.1] | |||||
Cardiovascular disorder [ICD10: I00-I99] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Congestive heart failure [ICD9: 428; ICD10: I50] | |||||
Diabetic nephropathy [ICD9: 250.4; ICD10: E11.21] | |||||
Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
Heart failure [ICD9: 428; ICD10: I50] | |||||
Oral contraceptive [ICD10: Z30] | |||||
Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
Unspecified [ICD code not available] | |||||
Function |
Receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. Binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels.
|
||||
BioChemical Class |
Zinc-finger
|
||||
Target Validation |
T72168
|
||||
UniProt ID | |||||
Sequence |
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYE QQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAI VKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPN AENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVP SPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF DGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL QKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVN TALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQV VKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYI KELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAML VEIISDQLPKVESGNAKPLYFHRK |
||||
Drugs and Mode of Action | |||||
Drug(s) | Desoxycorticosterone Acetate | Drug Info | Approved | Unspecified | [551871] |
Desoxycorticosterone Pivalate | Drug Info | Approved | Addison's disease | [550742] | |
Drospirenone | Drug Info | Approved | Oral contraceptive | [536361], [539900] | |
Eplerenone | Drug Info | Approved | Heart failure | [536361], [539902] | |
Fludrocortisone | Drug Info | Approved | Cerebral salt-wasting syndrome | [538426], [539899] | |
Spironolactone | Drug Info | Approved | Congestive heart failure | [536650], [539901] | |
BR-4628 | Drug Info | Phase 2 | Heart failure | [548620] | |
LY-2623091 | Drug Info | Phase 2 | Chronic kidney disease | [524840] | |
MT-3995 | Drug Info | Phase 2 | Diabetic nephropathy | [524170] | |
Nerenone | Drug Info | Phase 2 | Diabetic nephropathy | [551866] | |
ZK-91587 | Drug Info | Phase 2 | Cardiovascular disorder | [533431] | |
XL550 | Drug Info | Phase 1 | Type 2 diabetes | [550638] | |
PF-03882845 | Drug Info | Terminated | Diabetic nephropathy | [551489] | |
Inhibitor | (11-BETA)-11,21-DIHYDROXY-PREGN-4-ENE-3,20-DIONE | Drug Info | [551374] | ||
AL-43 | Drug Info | [526567] | |||
B-Octylglucoside | Drug Info | [551393] | |||
CB-1922 | Drug Info | [543902] | |||
EPIERENONE | Drug Info | [529171] | |||
LG-120838 | Drug Info | [534728] | |||
LGD-5552 | Drug Info | [529166] | |||
WAY-255348 | Drug Info | [529352] | |||
Antagonist | BR-4628 | Drug Info | [543902] | ||
LY-2623091 | Drug Info | [533270] | |||
MT-3995 | Drug Info | [533270] | |||
Nerenone | Drug Info | [543902] | |||
RU28318 | Drug Info | [543902] | |||
XL550 | Drug Info | [550638] | |||
ZK-91587 | Drug Info | [533431], [551871] | |||
Agonist | deoxycorticosterone | Drug Info | [533966] | ||
Fludrocortisone | Drug Info | [535856], [537575] | |||
[3H]aldosterone | Drug Info | [527764] | |||
Modulator | Desoxycorticosterone Acetate | Drug Info | [556264] | ||
Eplerenone | Drug Info | [556264] | |||
PF-03882845 | Drug Info | ||||
Spironolactone | Drug Info | [556264] | |||
Binder | Desoxycorticosterone Pivalate | Drug Info | [537791] | ||
Drospirenone | Drug Info | [536232] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Aldosterone-regulated sodium reabsorption | ||||
PathWhiz Pathway | Kidney Function | ||||
WikiPathways | ACE Inhibitor Pathway | ||||
References | |||||
Ref 524170 | ClinicalTrials.gov (NCT01756703) A Study to Evaluate Pharmacodynamics, Safety, Tolerability and Pharmacokinetics of MT-3995 in Type II Diabetic Nephropathy Subjects With Albuminuria. U.S. National Institutes of Health. | ||||
Ref 524840 | ClinicalTrials.gov (NCT02194465) A Study of LY2623091 in Participants With High Blood Pressure. U.S. National Institutes of Health. | ||||
Ref 533431 | ZK91587: a novel synthetic antimineralocorticoid displays high affinity for corticosterone (type I) receptors in the rat hippocampus. Life Sci. 1988;43(19):1537-43. | ||||
Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
Ref 536650 | Emerging drugs for complications of end-stage liver disease. Expert Opin Emerg Drugs. 2008 Mar;13(1):159-74. | ||||
Ref 538426 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010060. | ||||
Ref 539899 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2873). | ||||
Ref 539900 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2874). | ||||
Ref 539901 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2875). | ||||
Ref 539902 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2876). | ||||
Ref 548620 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027127) | ||||
Ref 526567 | J Med Chem. 2003 Mar 13;46(6):1016-30.Nonsteroidal selective glucocorticoid modulators: the effect of C-10 substitution on receptor selectivity and functional potency of 5-allyl-2,5-dihydro-2,2,4-trimethyl-1H-[1]benzopyrano[3,4-f]quinolines. | ||||
Ref 527764 | Stimulation of testosterone production in rat Leydig cells by aldosterone is mineralocorticoid receptor mediated. Mol Cell Endocrinol. 2005 Nov 24;243(1-2):35-42. Epub 2005 Sep 26. | ||||
Ref 529166 | Proc Natl Acad Sci U S A. 2007 Dec 4;104(49):19244-9. Epub 2007 Nov 21.Antiinflammatory glucocorticoid receptor ligand with reduced side effects exhibits an altered protein-protein interaction profile. | ||||
Ref 529171 | J Med Chem. 2007 Dec 27;50(26):6443-5. Epub 2007 Nov 27.(S)-N-{3-[1-cyclopropyl-1-(2,4-difluoro-phenyl)-ethyl]-1H-indol-7-yl}-methanesulfonamide: a potent, nonsteroidal, functional antagonist of themineralocorticoid receptor. | ||||
Ref 529352 | J Med Chem. 2008 Mar 27;51(6):1861-73. Epub 2008 Mar 5.Design, synthesis, and SAR of new pyrrole-oxindole progesterone receptor modulators leading to 5-(7-fluoro-3,3-dimethyl-2-oxo-2,3-dihydro-1H-indol-5-yl)-1-methyl-1H-pyrrole-2-carbonitrile (WAY-255348). | ||||
Ref 533270 | Nonsteroidal antagonists of the mineralocorticoid receptor. Curr Opin Nephrol Hypertens. 2015 Sep;24(5):417-24. | ||||
Ref 533431 | ZK91587: a novel synthetic antimineralocorticoid displays high affinity for corticosterone (type I) receptors in the rat hippocampus. Life Sci. 1988;43(19):1537-43. | ||||
Ref 533966 | Pharmacological and functional characterization of human mineralocorticoid and glucocorticoid receptor ligands. Eur J Pharmacol. 1993 Oct 15;247(2):145-54. | ||||
Ref 534728 | J Med Chem. 1998 Oct 22;41(22):4354-9.5-Benzylidene 1,2-dihydrochromeno[3,4-f]quinolines, a novel class of nonsteroidal human progesterone receptor agonists. | ||||
Ref 535856 | Mineralocorticoid receptor-mediated inhibition of the hypothalamic-pituitary-adrenal axis in aged humans. J Gerontol A Biol Sci Med Sci. 2003 Oct;58(10):B900-5. | ||||
Ref 536232 | Biochemical mechanisms of New Molecular Entities (NMEs) approved by United States FDA during 2001-2004: mechanisms leading to optimal efficacy and safety. | ||||
Ref 537791 | Characterization of rat brain aldosterone receptors reveals high affinity for corticosterone. Endocrinology. 1983 Dec;113(6):2043-51. | ||||
Ref 543902 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 626). |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.