Target General Infomation
Target ID
T58970
Former ID
TTDR00372
Target Name
Mitogen-activated protein kinase 1
Gene Name
MAPK1
Synonyms
ERK-2; ERT1; Extracellular signal-regulated kinase 2; MAP kinase 2; MAPK 2; Mitogen-activated protein kinase 2; P42 Mitogen-activated protein kinase; P42-MAPK; MAPK1
Target Type
Clinical Trial
Disease Arthritis [ICD9: 710-719; ICD10: M00-M25]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Restenosis [ICD10: I51.89]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Function
Acts as a transcriptional repressor. Binds to a [GC]AAA[GC] consensus sequence. Repress the expression of interferon gamma-induced genes. Seems to bind to the promoter of CCL5, DMP1, IFIH1, IFITM1, IRF7, IRF9, LAMP3, OAS1, OAS2, OAS3 and STAT1. Transcriptional activity is independent of kinase activity.
BioChemical Class
Kinase
Target Validation
T58970
UniProt ID
EC Number
EC 2.7.11.24
Sequence
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Drugs and Mode of Action
Drug(s) CI-1040 Drug Info Phase 2 Discovery agent [521505], [541019]
BVD-523 Drug Info Phase 1/2 Cancer [524205]
GDC-0994 Drug Info Phase 1 Solid tumours [524324]
VAN-10-4-eluting stent Drug Info Phase 1 Restenosis [551983]
SB220025 Drug Info Terminated Arthritis [541295], [546829]
Inhibitor (4-Fluoro-phenyl)-(9-methyl-9H-purin-6-yl)-amine Drug Info [527421]
4,5,6,7-tetrabromo-1H-benzo[d][1,2,3]triazole Drug Info [527308]
4-[(3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol Drug Info [528490]
AEZS-131 Drug Info [543428]
BISINDOLYLMALEIMIDE IX Drug Info [525872]
BMS-536924 Drug Info [527711]
CHIR-99021 Drug Info [526553]
CI-1040 Drug Info [525872]
DEBROMOHYMENIALDISINE Drug Info [527140]
ERK inhibitor III Drug Info [528449]
ERK inhibitors Drug Info [543428]
FR-180204 Drug Info [527815]
GF-109203 Drug Info [525872]
KN-62 Drug Info [525872]
KT-5720 Drug Info [525872]
Phosphonothreonine Drug Info [551393]
RO-316233 Drug Info [525872]
Ro-4396686 Drug Info [528018]
SB220025 Drug Info [551393]
SCH772984 Drug Info [532324]
VAN-10-4-eluting stent Drug Info [550172]
Modulator BVD-523 Drug Info
GDC-0994 Drug Info
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Oocyte meiosis
mTOR signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Adherens junction
Gap junction
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Type II diabetes mellitus
Aldosterone-regulated sodium reabsorption
Alzheimer&#039
s disease
Prion diseases
Alcoholism
Shigellosis
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
NetPath Pathway IL2 Signaling Pathway
PANTHER Pathway Alzheimer disease-amyloid secretase pathway
Angiogenesis
Apoptosis signaling pathway
B cell activation
EGF receptor signaling pathway
Endothelin signaling pathway
FGF signaling pathway
Inflammation mediated by chemokine and cytokine signaling pathway
Insulin/IGF pathway-mitogen activated protein kinase kinase/MAP kinase cascade
Interferon-gamma signaling pathway
Interleukin signaling pathway
PDGF signaling pathway
Parkinson disease
TGF-beta signaling pathway
T cell activation
VEGF signaling pathway
Ras Pathway
Angiotensin II-stimulated signaling through G proteins and beta-arrestin
CCKR signaling map ST
Pathway Interaction Database Fc-epsilon receptor I signaling in mast cells
Endothelins
BCR signaling pathway
Signaling events mediated by PRL
ErbB4 signaling events
GMCSF-mediated signaling events
Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met)
S1P3 pathway
EPHB forward signaling
Osteopontin-mediated events
S1P4 pathway
Presenilin action in Notch and Wnt signaling
TRAIL signaling pathway
CDC42 signaling events
Signaling events regulated by Ret tyrosine kinase
Angiopoietin receptor Tie2-mediated signaling
S1P1 pathway
Regulation of Telomerase
Netrin-mediated signaling events
Glucocorticoid receptor regulatory network
Arf6 downstream pathway
mTOR signaling pathway
Class IB PI3K non-lipid kinase events
IL2-mediated signaling events
EGF receptor (ErbB1) signaling pathway
Ras signaling in the CD4+ TCR pathway
Ceramide signaling pathway
Integrins in angiogenesis
IFN-gamma pathway
ErbB1 downstream signaling
ATF-2 transcription factor network
ErbB2/ErbB3 signaling events
BMP receptor signaling
ALK1 signaling events
PDGFR-beta signaling pathway
Neurotrophic factor-mediated Trk receptor signaling
Syndecan-1-mediated signaling events
Retinoic acid receptors-mediated signaling
Nongenotropic Androgen signaling
CXCR3-mediated signaling events
VEGFR1 specific signals
Regulation of cytoplasmic and nuclear SMAD2/3 signaling
Signaling events mediated by VEGFR1 and VEGFR2
Syndecan-2-mediated signaling events
Cellular roles of Anthrax toxin
S1P2 pathway
Trk receptor signaling mediated by the MAPK pathway
Downstream signaling in na&amp
#xef
ve CD8+ T cells
VEGFR3 signaling in lymphatic endothelium
Alpha-synuclein signaling
FGF signaling pathway
Signaling events mediated by focal adhesion kinase
PathWhiz Pathway Intracellular Signalling Through Adenosine Receptor A2a and Adenosine
Intracellular Signalling Through Adenosine Receptor A2b and Adenosine
Fc Epsilon Receptor I Signaling in Mast Cells
Insulin Signalling
Reactome RAF-independent MAPK1/3 activation
MAPK1 (ERK2) activation
Golgi Cisternae Pericentriolar Stack Reorganization
ERK/MAPK targets
Regulation of actin dynamics for phagocytic cup formation
Oxidative Stress Induced Senescence
Senescence-Associated Secretory Phenotype (SASP)
Oncogene Induced Senescence
FCERI mediated MAPK activation
Regulation of HSF1-mediated heat shock response
NCAM signaling for neurite out-growth
Recycling pathway of L1
CREB phosphorylation through the activation of Ras
Activation of the AP-1 family of transcription factors
Thrombin signalling through proteinase activated receptors (PARs)
Negative regulation of FGFR1 signaling
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
RHO GTPases Activate WASPs and WAVEs
RAF/MAP kinase cascade
MAP2K and MAPK activation
Negative feedback regulation of MAPK pathway
Negative regulation of MAPK pathway
Signal attenuation
Advanced glycosylation endproduct receptor signaling
Gastrin-CREB signalling pathway via PKC and MAPK
Growth hormone receptor signaling
WikiPathways Toll-like receptor signaling pathway
Serotonin Receptor 4/6/7 and NR3C Signaling
Serotonin Receptor 2 and ELK-SRF/GATA4 signaling
Serotonin HTR1 Group and FOS Pathway
Vitamin A and Carotenoid Metabolism
DNA Damage Response (only ATM dependent)
TCR Signaling Pathway
ErbB Signaling Pathway
Hypothetical Network for Drug Addiction
Senescence and Autophagy in Cancer
EPO Receptor Signaling
Regulation of Actin Cytoskeleton
IL-2 Signaling Pathway
Insulin Signaling
EGF/EGFR Signaling Pathway
MAPK Cascade
IL-4 Signaling Pathway
MAPK Signaling Pathway
TGF beta Signaling Pathway
IL-6 signaling pathway
Signaling of Hepatocyte Growth Factor Receptor
Kit receptor signaling pathway
TCA Cycle Nutrient Utilization and Invasiveness of Ovarian Cancer
Apoptosis-related network due to altered Notch3 in ovarian cancer
IL-3 Signaling Pathway
Bladder Cancer
Cardiac Hypertrophic Response
MAP kinase activation in TLR cascade
Fc epsilon receptor (FCERI) signaling
Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell
RAF/MAP kinase cascade
Nanoparticle-mediated activation of receptor signaling
Structural Pathway of Interleukin 1 (IL-1)
Genes and (Common) Pathways Underlying Drug Addiction
EBV LMP1 signaling
Signal Transduction of S1P Receptor
Nifedipine Activity
Aryl Hydrocarbon Receptor
PDGF Pathway
Alpha 6 Beta 4 signaling pathway
Spinal Cord Injury
BDNF signaling pathway
Integrated Pancreatic Cancer Pathway
Oncostatin M Signaling Pathway
Corticotropin-releasing hormone
Interleukin-11 Signaling Pathway
AGE/RAGE pathway
TNF alpha Signaling Pathway
B Cell Receptor Signaling Pathway
Prostate Cancer
Signaling Pathways in Glioblastoma
TSLP Signaling Pathway
IL-9 Signaling Pathway
Endothelin Pathways
IL17 signaling pathway
Alzheimers Disease
IL-7 Signaling Pathway
TWEAK Signaling Pathway
FSH signaling pathway
Leptin signaling pathway
RANKL/RANK Signaling Pathway
Integrated Breast Cancer Pathway
Opioid Signalling
IL-1 signaling pathway
Thrombin signalling through proteinase activated receptors (PARs)
Signaling by FGFR
Integrin-mediated Cell Adhesion
L1CAM interactions
Advanced glycosylation endproduct receptor signaling
Heart Development
Type II diabetes mellitus
MicroRNAs in cardiomyocyte hypertrophy
Angiogenesis
Physiological and Pathological Hypertrophy of the Heart
Regulation of toll-like receptor signaling pathway
Osteopontin Signaling
IL-5 Signaling Pathway
References
Ref 521505ClinicalTrials.gov (NCT00033384) CI-1040 in Treating Patients With Advanced Breast, Colon, Pancreatic, or Non-Small Cell Lung Cancer. U.S. National Institutes of Health.
Ref 524205ClinicalTrials.gov (NCT01781429) Phase I Dose-Escalation, Safety, Pharmacokinetic and Pharmacodynamic Study of BVD-523 in Patients With Advanced Malignancies. U.S. National Institutes of Health.
Ref 524324ClinicalTrials.gov (NCT01875705) A Dose-Escalation Study of GDC-0994 in Patients With Locally Advanced or Metastatic Solid Tumors. U.S. National Institutes of Health.
Ref 541019(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5676).
Ref 541295(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6038).
Ref 546829Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010505)
Ref 551983Drug-Eluting Stent for High Risk Patients. University of Strathclyde Glasgow. 2015
Ref 525872Biochem J. 2000 Oct 1;351(Pt 1):95-105.Specificity and mechanism of action of some commonly used protein kinase inhibitors.
Ref 526553Selective glycogen synthase kinase 3 inhibitors potentiate insulin activation of glucose transport and utilization in vitro and in vivo. Diabetes. 2003 Mar;52(3):588-95.
Ref 527140Bioorg Med Chem Lett. 2004 Aug 16;14(16):4319-21.Potent inhibition of checkpoint kinase activity by a hymenialdisine-derived indoloazepine.
Ref 527308J Med Chem. 2004 Dec 2;47(25):6239-47.Optimization of protein kinase CK2 inhibitors derived from 4,5,6,7-tetrabromobenzimidazole.
Ref 527421J Med Chem. 2005 Feb 10;48(3):710-22.Synthesis and biological testing of purine derivatives as potential ATP-competitive kinase inhibitors.
Ref 527711J Med Chem. 2005 Sep 8;48(18):5639-43.Discovery of a (1H-benzoimidazol-2-yl)-1H-pyridin-2-one (BMS-536924) inhibitor of insulin-like growth factor I receptor kinase with in vivo antitumor activity.
Ref 527815Bioorg Med Chem Lett. 2006 Jan 1;16(1):55-8. Epub 2005 Oct 18.Crystal structure of human ERK2 complexed with a pyrazolo[3,4-c]pyridazine derivative.
Ref 528018Bioorg Med Chem Lett. 2006 Apr 1;16(7):1950-3. Epub 2006 Feb 3.Biological evaluation of a multi-targeted small molecule inhibitor of tumor-induced angiogenesis.
Ref 528449Characterization of ATP-independent ERK inhibitors identified through in silico analysis of the active ERK2 structure. Bioorg Med Chem Lett. 2006 Dec 15;16(24):6281-7. Epub 2006 Sep 26.
Ref 528490J Med Chem. 2006 Nov 2;49(22):6500-9.4-arylazo-3,5-diamino-1H-pyrazole CDK inhibitors: SAR study, crystal structure in complex with CDK2, selectivity, and cellular effects.
Ref 532324Discovery of a novel ERK inhibitor with activity in models of acquired resistance to BRAF and MEK inhibitors. Cancer Discov. 2013 Jul;3(7):742-50.
Ref 543428(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1495).
Ref 550172WO patent application no. 2013,1850,32, Nanotherapeutics for drug targeting.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.