Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T89529
|
||||
Former ID |
TTDR01437
|
||||
Target Name |
mRNA of Protein tyrosine phosphatase-1B
|
||||
Gene Name |
PTPN1
|
||||
Synonyms |
mRNA of PTP-1B; mRNA of PTPN1; mRNA of Protein-tyrosine phosphatase 1B; mRNA of Tyrosine-protein phosphatase non-receptor type 1; PTPN1
|
||||
Target Type |
Successful
|
||||
Disease | Colour dead tissues [ICD code not available] | ||||
Infections [ICD9: 001-139; ICD10: A00-B99] | |||||
Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
Function |
Tyrosine-protein phosphatase which acts as a regulator of endoplasmic reticulum unfolded protein response. Mediates dephosphorylation of EIF2AK3/PERK; inactivating the protein kinase activity of EIF2AK3/PERK. May play an important role in CKII- and p60c-src-induced signal transduction cascades. May regulate the EFNA5-EPHA3 signaling pathway which modulates cell reorganization and cell-cell repulsion. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of MET.
|
||||
BioChemical Class |
Target of antisense drug
|
||||
Target Validation |
T89529
|
||||
UniProt ID | |||||
EC Number |
EC 3.1.3.48
|
||||
Sequence |
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT AGAYLCYRFLFNSNT |
||||
Structure |
1A5Y; 1AAX; 1BZC; 1BZH; 1BZJ; 1C83; 1C84; 1C85; 1C86; 1C87; 1C88; 1ECV; 1EEN; 1EEO; 1G1F; 1G1G; 1G1H; 1G7F; 1G7G; 1GFY; 1I57; 1JF7; 1KAK; 1KAV; 1L8G; 1LQF; 1NL9; 1NNY; 1NO6; 1NWE; 1NWL; 1NZ7; 1OEM; 1OEO; 1OES; 1OET; 1OEU; 1OEV; 1ONY; 1ONZ; 1PA1; 1PH0; 1PTT; 1PTU; 1PTV; 1PTY; 1PXH; 1PYN; 1Q1M; 1Q6J; 1Q6M; 1Q6N; 1Q6P; 1Q6S; 1Q6T; 1QXK; 1SUG; 1T48; 1T49; 1T4J; 1WAX; 1XBO; 2AZR; 2B07; 2B4S; 2BGD; 2BGE; 2CM2; 2CM3; 2CM7; 2CM8; 2CMA; 2CMB; 2CMC; 2CNE; 2CNF; 2CNG; 2CNH; 2CNI; 2F6F; 2F6T; 2F6V; 2F6W; 2F6Y; 2F6Z; 2F70; 2F71; 2FJM; 2FJN; 2H4G; 2H4K; 2HB1; 2HNP; 2HNQ; 2NT7; 2NTA; 2QBP; 2QBQ; 2QBR; 2QBS; 2VEU; 2VEV; 2VEW; 2VEX; 2VEY; 2ZMM; 2ZN7; 3A5J; 3A5K; 3CWE; 3D9C; 3EAX; 3EB1; 3EU0; 3I7Z; 3I80; 3QKP; 3QKQ; 3SME; 3ZMP; 3ZMQ; 3ZV2; 4BJO; 4I8N; 4QAH; 4QBE; 1A5Y; 1AAX; 1BZC; 1BZH; 1BZJ; 1C83; 1C84; 1C85; 1C86; 1C87; 1C88; 1ECV; 1EEN; 1EEO; 1G1F; 1G1G; 1G1H; 1G7F; 1G7G; 1GFY; 1I57; 1JF7; 1KAK; 1KAV; 1L8G; 1LQF; 1NL9; 1NNY; 1NO6; 1NWE; 1NWL; 1NZ7; 1OEM; 1OEO; 1OES; 1OET; 1OEU; 1OEV; 1ONY; 1ONZ; 1PA1; 1PH0; 1PTT; 1PTU; 1PTV; 1PTY; 1PXH; 1PYN; 1Q1M; 1Q6J; 1Q6M; 1Q6N; 1Q6P; 1Q6S; 1Q6T; 1QXK; 1SUG; 1T48; 1T49; 1T4J; 1WAX; 1XBO; 2AZR; 2B07; 2B4S;2BGD; 2BGE; 2CM2; 2CM3; 2CM7; 2CM8; 2CMA; 2CMB; 2CMC; 2CNE; 2CNF; 2CNG; 2CNH; 2CNI; 2F6F; 2F6T; 2F6V; 2F6W; 2F6Y; 2F6Z; 2F70; 2F71; 2FJM; 2FJN; 2H4G; 2H4K; 2HB1; 2HNP; 2HNQ; 2NT7; 2NTA; 2QBP; 2QBQ; 2QBR; 2QBS; 2VEU; 2VEV; 2VEW; 2VEX; 2VEY; 2ZMM; 2ZN7; 3A5J; 3A5K; 3CWE; 3D9C; 3EAX; 3EB1; 3EU0; 3I7Z; 3I80; 3QKP; 3QKQ; 3SME; 3ZMP; 3ZMQ; 3ZV2; 4BJO; 4I8N; 4QAH; 4QBE
|
||||
Drugs and Mode of Action | |||||
Drug(s) | Hydrogen peroxide | Drug Info | Approved | Infections | [539576], [551871] |
TRYPAN BLUE | Drug Info | Approved | Colour dead tissues | [531351] | |
ISIS 113715 | Drug Info | Phase 2 | Type 2 diabetes | [536259] | |
ISIS-PTP1Brx | Drug Info | Phase 2 | Type 2 diabetes | [524392] | |
ISIS-PTP1B | Drug Info | Preclinical | Type 2 diabetes | [551052] | |
ERTIPROTAFIB | Drug Info | Terminated | Type 2 diabetes | [527242] | |
Inhibitor | 1,2,3,4,6-penta-O-galloyl-D-glucopyranose | Drug Info | [531140] | ||
1,2,5-THIADIAZOLIDIN-3-ONE-1,1-DIOXIDE | Drug Info | [551374] | |||
1,2-NAPHTHOQUINONE | Drug Info | [526377] | |||
1-Iodyl-3-nitro-benzene | Drug Info | [525449] | |||
1-Iodyl-4-nitro-benzene | Drug Info | [525449] | |||
1-METHYL-3-PHENYL-1H-PYRAZOL-5-YLSULFAMIC ACID | Drug Info | [551391] | |||
16-alphaH,17-isovaleryloxy-ent-kauran-19-oic acid | Drug Info | [528088] | |||
18alpha-Glycyrrhetic acid | Drug Info | [528115] | |||
18beta-Glycyrrhetic acid | Drug Info | [528115] | |||
19alpha,24-dihydroxyurs-12-en-3-on-28-oic acid | Drug Info | [529697] | |||
2-(Oxalyl-Amino)-Benzoic Acid | Drug Info | [551393] | |||
2-Methyl-2,4-Pentanediol | Drug Info | [551393] | |||
24-hydroxyursolic acid | Drug Info | [529697] | |||
3,9-Dihydroxy-4-prenyl-[6aR,11aR]pterocarpan | Drug Info | [530454] | |||
3-(4,5-Bis-biphenyl-4-yl-1H-imidazol-2-yl)-phenol | Drug Info | [526334] | |||
3-(Oxalyl-Amino)-Naphthalene-2-Carboxylic Acid | Drug Info | [551393] | |||
3-epi-masilinic acid | Drug Info | [530467] | |||
3-Iodyl-benzoic acid | Drug Info | [525449] | |||
3-isopropyl-4-(phenylthio)naphthalene-1,2-dione | Drug Info | [527986] | |||
3-oxoolean-12-en-27-oic acid | Drug Info | [528115] | |||
3alpha,24-dihydroxyolean-12-en-27-oic acid | Drug Info | [528115] | |||
3beta,6beta-dihydroxyolean-12-en-27-oic acid | Drug Info | [528115] | |||
3beta-acetoxyolean-12-en-27-oic acid | Drug Info | [528115] | |||
3beta-hydroxyolean-12-en-27-oic acid | Drug Info | [528115] | |||
3beta-hydroxyurs-12-en-27-oic acid | Drug Info | [528115] | |||
4'-((2-butylbenzofuran-3-yl)methyl)biphenyl-4-ol | Drug Info | [530028] | |||
4'-(2-butylbenzofuran-3-yl)biphenyl-4-ol | Drug Info | [530028] | |||
4-(p-toluidino)-3-isopropylnaphthalene-1,2-dione | Drug Info | [527986] | |||
4-Iodyl-benzoic acid | Drug Info | [525449] | |||
5-deoxyabyssinin II | Drug Info | [528828] | |||
6-(Oxalyl-Amino)-1h-Indole-5-Carboxylic Acid | Drug Info | [551393] | |||
Abyssinin I | Drug Info | [528828] | |||
Abyssinin II | Drug Info | [528828] | |||
Abyssinoflavanone VI | Drug Info | [528828] | |||
Abyssinoflavanone VII | Drug Info | [528828] | |||
Abyssinone-IV | Drug Info | [528537] | |||
Abyssinone-VI-4-O-methyl ether | Drug Info | [528537] | |||
Acetate Ion | Drug Info | [551393] | |||
ALBAFURAN A | Drug Info | [530464] | |||
Augustic acid | Drug Info | [530467] | |||
B-Octylglucoside | Drug Info | [551393] | |||
BURTTINONE | Drug Info | [529806] | |||
CAULERPIN | Drug Info | [528096] | |||
CHROMOTROPATE | Drug Info | [527017] | |||
Compound 15 | Drug Info | [551393] | |||
Compound 19 | Drug Info | [551393] | |||
Compound 9 | Drug Info | [551393] | |||
Cysteine Sulfenic Acid | Drug Info | [551391] | |||
Cysteinesulfonic Acid | Drug Info | [551393] | |||
Double Oxidized Cysteine | Drug Info | [551393] | |||
DYSIDINE | Drug Info | [529869] | |||
ERTIPROTAFIB | Drug Info | [529004] | |||
ERYBREADIN B | Drug Info | [530454] | |||
Erybreadin C | Drug Info | [530454] | |||
Erybreadin D | Drug Info | [530454] | |||
Erysubin E | Drug Info | [530454] | |||
ERYTHRIBYSSIN A | Drug Info | [530454] | |||
FOLITENOL | Drug Info | [530454] | |||
FORMYLCHROMONE | Drug Info | [531033] | |||
Hydrogen peroxide | Drug Info | [525449] | |||
Iodyl-benzene | Drug Info | [525449] | |||
Isochroman mono-carboxylic acid | Drug Info | [531033] | |||
ISOTHIAZOLIDINONE ANALOG | Drug Info | [551374] | |||
Isoxazolecarboxylic acid | Drug Info | [531033] | |||
KR61639 | Drug Info | [535898] | |||
Kuwanon J | Drug Info | [530464] | |||
Kuwanon L | Drug Info | [527927] | |||
Kuwanon R | Drug Info | [530464] | |||
Kuwanon V | Drug Info | [530464] | |||
LICOAGROCHACONE A | Drug Info | [530275] | |||
LICOAGROCHALCONE A | Drug Info | [528828] | |||
MASLINIC ACID | Drug Info | [530467] | |||
Methyl 3beta-hydroxyolean-12-en-28-oate | Drug Info | [528115] | |||
Methyl3beta-hydroxyolean-12-en-27-oate | Drug Info | [528115] | |||
Mulberrofuran C | Drug Info | [527927] | |||
Mulberrofuran D | Drug Info | [530464] | |||
Mulberrofuran W | Drug Info | [530464] | |||
NEORAUTENOL | Drug Info | [530454] | |||
Novo Nordisk a/S Compound | Drug Info | [551393] | |||
OHIOENSIN A | Drug Info | [529192] | |||
Ohioensin C | Drug Info | [529192] | |||
Ohioensin F | Drug Info | [529192] | |||
Ohioensin G | Drug Info | [529192] | |||
OLEANOLIC_ACID | Drug Info | [530332] | |||
Oleanonic acid | Drug Info | [529697] | |||
Oxalylaminobenzoic acid | Drug Info | [531033] | |||
PARA-(BENZOYL)-PHENYLALANINE | Drug Info | [551374] | |||
PHELLIGRIDIN I | Drug Info | [528656] | |||
PNU177836 | Drug Info | [551393] | |||
Pomolic acid | Drug Info | [529697] | |||
RK-682 | Drug Info | [531115] | |||
Rotungenic acid | Drug Info | [529697] | |||
Sanggenon C | Drug Info | [527927] | |||
Sanggenon G | Drug Info | [527927] | |||
SIGMOIDIN A | Drug Info | [528828] | |||
SIGMOIDIN B | Drug Info | [528828] | |||
Sigmoidin F | Drug Info | [528828] | |||
Sp7343-Sp7964 | Drug Info | [551393] | |||
Spathodic acid | Drug Info | [529697] | |||
TRYPAN BLUE | Drug Info | [527017] | |||
URSOLIC ACID | Drug Info | [530454] | |||
USIMINE A | Drug Info | [529326] | |||
USNIC ACID | Drug Info | [529326] | |||
UVAOL | Drug Info | [529697] | |||
[[4-(Aminomethyl)Phenyl]Amino]Oxo-Acetic Acid, | Drug Info | [551393] | |||
Modulator | ISIS-PTP1Brx | Drug Info | [551949] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Adherens junction | ||||
Insulin signaling pathway | |||||
NetPath Pathway | FSH Signaling Pathway | ||||
PANTHER Pathway | Cadherin signaling pathway | ||||
Pathway Interaction Database | Insulin Pathway | ||||
Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met) | |||||
Signaling events mediated by PTP1B | |||||
Calcineurin-regulated NFAT-dependent transcription in lymphocytes | |||||
Signaling events mediated by TCPTP | |||||
IGF1 pathway | |||||
EGF receptor (ErbB1) signaling pathway | |||||
Posttranslational regulation of adherens junction stability and dissassembly | |||||
PDGFR-beta signaling pathway | |||||
N-cadherin signaling events | |||||
Reactome | Integrin alphaIIb beta3 signaling | ||||
Regulation of IFNG signaling | |||||
Regulation of IFNA signaling | |||||
Growth hormone receptor signaling | |||||
WikiPathways | Insulin Signaling | ||||
Growth hormone receptor signaling | |||||
Leptin signaling pathway | |||||
Interferon gamma signaling | |||||
Interferon alpha/beta signaling | |||||
Integrin alphaIIb beta3 signaling | |||||
References | |||||
Ref 524392 | ClinicalTrials.gov (NCT01918865) Safety, Tolerability, and Efficacy of ISIS-PTP1BRx in Type 2 Diabetes. U.S. National Institutes of Health. | ||||
Ref 527242 | Ertiprotafib improves glycemic control and lowers lipids via multiple mechanisms. Mol Pharmacol. 2005 Jan;67(1):69-77. Epub 2004 Oct 8. | ||||
Ref 536259 | Lack of pharmacokinetic interaction for ISIS 113715, a 2'-0-methoxyethyl modified antisense oligonucleotide targeting protein tyrosine phosphatase 1B messenger RNA, with oral antidiabetic compounds metformin, glipizide or rosiglitazone. Clin Pharmacokinet. 2006;45(8):789-801. | ||||
Ref 539576 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2448). | ||||
Ref 525449 | Bioorg Med Chem Lett. 1999 Feb 8;9(3):353-6.Periodinates: a new class of protein tyrosine phosphatase inhibitors. | ||||
Ref 526334 | J Med Chem. 2002 May 23;45(11):2213-21.Molecular docking and high-throughput screening for novel inhibitors of protein tyrosine phosphatase-1B. | ||||
Ref 526377 | Bioorg Med Chem Lett. 2002 Aug 5;12(15):1941-6.Synthesis and PTP1B inhibition of 1,2-naphthoquinone derivatives as potent anti-diabetic agents. | ||||
Ref 527017 | Bioorg Med Chem Lett. 2004 Apr 19;14(8):1923-6.Evans Blue and other dyes as protein tyrosine phosphatase inhibitors. | ||||
Ref 527927 | Bioorg Med Chem Lett. 2006 Mar 1;16(5):1426-9. Epub 2005 Dec 13.Protein tyrosine phosphatase 1B inhibitors from Morus root bark. | ||||
Ref 527986 | Bioorg Med Chem Lett. 2006 Apr 1;16(7):1905-8. Epub 2006 Jan 24.Synthesis of miltirone analogues as inhibitors of Cdc25 phosphatases. | ||||
Ref 528088 | Bioorg Med Chem Lett. 2006 Jun 1;16(11):3061-4. Epub 2006 Mar 20.Inhibition of protein tyrosine phosphatase 1B by diterpenoids isolated from Acanthopanax koreanum. | ||||
Ref 528096 | Bioorg Med Chem Lett. 2006 Jun 1;16(11):2947-50. Epub 2006 Mar 24.Two novel aromatic valerenane-type sesquiterpenes from the Chinese green alga Caulerpa taxifolia. | ||||
Ref 528115 | Bioorg Med Chem Lett. 2006 Jun 15;16(12):3273-6. Epub 2006 Mar 31.Protein tyrosine phosphatase 1B inhibitory activity of triterpenes isolated from Astilbe koreana. | ||||
Ref 528537 | J Nat Prod. 2006 Nov;69(11):1572-6.Protein tyrosine phosphatase-1B inhibitory activity of isoprenylated flavonoids isolated from Erythrina mildbraedii. | ||||
Ref 528656 | J Nat Prod. 2007 Feb;70(2):296-9. Epub 2007 Feb 6.Structures, biogenesis, and biological activities of pyrano[4,3-c]isochromen-4-one derivatives from the Fungus Phellinus igniarius. | ||||
Ref 528828 | J Nat Prod. 2007 Jun;70(6):1039-42. Epub 2007 May 10.Isoprenylated flavonoids from the stem bark of Erythrina abyssinica. | ||||
Ref 529004 | Bioorg Med Chem Lett. 2007 Oct 1;17(19):5357-60. Epub 2007 Aug 15.2-O-carboxymethylpyrogallol derivatives as PTP1B inhibitors with antihyperglycemic activity. | ||||
Ref 529192 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):772-5. Epub 2007 Nov 17.Ohioensins F and G: protein tyrosine phosphatase 1B inhibitory benzonaphthoxanthenones from the Antarctic moss Polytrichastrum alpinum. | ||||
Ref 529326 | J Nat Prod. 2008 Apr;71(4):710-2. Epub 2008 Feb 21.Usimines A-C, bioactive usnic acid derivatives from the Antarctic lichen Stereocaulon alpinum. | ||||
Ref 529697 | J Nat Prod. 2008 Oct;71(10):1775-8. Epub 2008 Sep 18.Triterpenoids from the leaves of Diospyros kaki (persimmon) and their inhibitory effects on protein tyrosine phosphatase 1B. | ||||
Ref 529806 | Bioorg Med Chem. 2008 Dec 15;16(24):10356-62. Epub 2008 Oct 10.Flavanones from the stem bark of Erythrina abyssinica. | ||||
Ref 529869 | Bioorg Med Chem Lett. 2009 Jan 15;19(2):390-2. Epub 2008 Nov 24.A novel sesquiterpene quinone from Hainan sponge Dysidea villosa. | ||||
Ref 530028 | Bioorg Med Chem. 2009 Apr 1;17(7):2658-72. Epub 2009 Mar 5.Synthesis, activity and molecular modeling of a new series of chromones as low molecular weight protein tyrosine phosphatase inhibitors. | ||||
Ref 530275 | Bioorg Med Chem Lett. 2009 Sep 1;19(17):5155-7. Epub 2009 Jul 24.Inhibitory effect of chalcones and their derivatives from Glycyrrhiza inflata on protein tyrosine phosphatase 1B. | ||||
Ref 530332 | J Nat Prod. 2009 Sep;72(9):1620-6.Chemical Constituents of the Roots of Euphorbia micractina. | ||||
Ref 530454 | Bioorg Med Chem Lett. 2009 Dec 1;19(23):6745-9. Epub 2009 Oct 1.Cytotoxic and PTP1B inhibitory activities from Erythrina abyssinica. | ||||
Ref 530464 | Bioorg Med Chem Lett. 2009 Dec 1;19(23):6759-61. Epub 2009 Oct 7.Protein tyrosine phosphatase 1B inhibitors isolated from Morus bombycis. | ||||
Ref 530467 | Bioorg Med Chem Lett. 2009 Dec 1;19(23):6618-22. Epub 2009 Oct 8.Synthesis and biological evaluation of heterocyclic ring-substituted maslinic acid derivatives as novel inhibitors of protein tyrosine phosphatase 1B. | ||||
Ref 531033 | Eur J Med Chem. 2010 Sep;45(9):3709-18. Epub 2010 May 15.Synthesis and evaluation of some novel dibenzo[b,d]furan carboxylic acids as potential anti-diabetic agents. | ||||
Ref 531115 | Bioorg Med Chem Lett. 2010 Sep 15;20(18):5398-401. Epub 2010 Aug 1.Prenylflavonoids from Glycyrrhiza uralensis and their protein tyrosine phosphatase-1B inhibitory activities. | ||||
Ref 531140 | J Nat Prod. 2010 Sep 24;73(9):1578-81.Bioactivity-guided isolation of 1,2,3,4,6-Penta-O-galloyl-D-glucopyranose from Paeonia lactiflora roots as a PTP1B inhibitor. | ||||
Ref 535898 | Discovery of a novel protein tyrosine phosphatase-1B inhibitor, KR61639: potential development as an antihyperglycemic agent. Eur J Pharmacol. 2004 Feb 6;485(1-3):333-9. | ||||
Ref 536259 | Lack of pharmacokinetic interaction for ISIS 113715, a 2'-0-methoxyethyl modified antisense oligonucleotide targeting protein tyrosine phosphatase 1B messenger RNA, with oral antidiabetic compounds metformin, glipizide or rosiglitazone. Clin Pharmacokinet. 2006;45(8):789-801. | ||||
Ref 551052 | Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2011). | ||||
Ref 551054 | Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2009). |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.