Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T39977
|
||||
| Former ID |
TTDC00103
|
||||
| Target Name |
Macrophage migration inhibitory factor
|
||||
| Gene Name |
MIF
|
||||
| Synonyms |
GIF; Glycosylation-inhibiting factor; Phenylpyruvate tautomerase; MIF
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Refractory autoimmune diseases [ICD9: 279.4; ICD10: D84.9, M35.9] | |||||
| Function |
Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti- inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is notclear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
|
||||
| BioChemical Class |
Intramolecular oxidoreductases
|
||||
| Target Validation |
T39977
|
||||
| UniProt ID | |||||
| EC Number |
EC 5.3.3.12
|
||||
| Sequence |
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 3,4-Dihydroxycinnamic Acid | Drug Info | [551393] | ||
| 3-(4-HYDROXY-PHENYL)PYRUVIC ACID | Drug Info | [551374] | |||
| 4-HYDROXYBENZALDEHYDE O-(CYCLOHEXYLCARBONYL)OXIME | Drug Info | [551374] | |||
| 6-HYDROXY-1,3-BENZOTHIAZOLE-2-SULFONAMIDE | Drug Info | [551374] | |||
| Anti-MIF antibodies | Drug Info | [544220] | |||
| AVP-13546 | Drug Info | [529649] | |||
| AVP-13748 | Drug Info | [529649] | |||
| COR100140 | Drug Info | [550565] | |||
| ISO-1 | Drug Info | [535444] | |||
| NAPQI | Drug Info | [529649] | |||
| Pathways | |||||
| KEGG Pathway | Tyrosine metabolism | ||||
| Phenylalanine metabolism | |||||
| PathWhiz Pathway | Tyrosine Metabolism | ||||
| WikiPathways | Spinal Cord Injury | ||||
| Adipogenesis | |||||
| References | |||||
| Ref 535444 | The tautomerase active site of macrophage migration inhibitory factor is a potential target for discovery of novel anti-inflammatory agents. J Biol Chem. 2002 Jul 12;277(28):24976-82. Epub 2002 May 7. | ||||
| Ref 544220 | Neutralization of Macrophage Migration Inhibitory Factor (MIF) by Fully Human Antibodies Correlates with Their Specificity for the beta-Sheet Structure of MIF. J Biol Chem. 2012 March 2; 287(10): 7446-7455. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

