Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T67272
|
||||
| Former ID |
TTDR00784
|
||||
| Target Name |
Aminopeptidase N
|
||||
| Gene Name |
ANPEP
|
||||
| Synonyms |
Alanyl aminopeptidase; Aminopeptidase M; Gp150; HAPN; Microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; ANPEP
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Psoriasis [ICD9: 696; ICD10: L40] | ||||
| Function |
Broad specificity aminopeptidase. Plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May play a critical role in the pathogenesis of cholesterol gallstone disease. May be involved in the metabolism of regulatory peptides of diverse cell types, responsible for the processing of peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. Found to cleave antigen peptides bound to major histocompatibility complex class II molecules of presenting cells and to degrade neurotransmitters at synaptic junctions. Is also implicated as a regulator of IL-8 bioavailability in the endometrium, and therefore may contribute to the regulation of angiogenesis. Is used as a marker for acute myeloid leukemia and plays a role in tumor invasion. In case of human coronavirus 229E (HCoV-229E) infection, serves as receptor for HCoV-229E spike glycoprotein. Mediates as well human cytomegalovirus (HCMV) infection.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T67272
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.11.2
|
||||
| Sequence |
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPA
SATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVI IIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDS EFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP KDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLV TYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKG ASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIM NRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQ IINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKN YLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWM ENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQ WFTENSK |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | (1-Amino-2-phenyl-ethyl)-phosphinic acid | Drug Info | [525524] | ||
| (1-Amino-3-methyl-butyl)-phosphinic acid | Drug Info | [525524] | |||
| (1-Amino-3-methylsulfanyl-propyl)-phosphinic acid | Drug Info | [525524] | |||
| (1-Amino-3-phenyl-propyl)-phosphinic acid | Drug Info | [525524] | |||
| (1-Amino-ethyl)-phosphinic acid | Drug Info | [525524] | |||
| (Amino-phenyl-methyl)-phosphinic acid | Drug Info | [525524] | |||
| (S)-2-Amino-2-phenyl-ethanethiol | Drug Info | [525524] | |||
| (S)-2-Amino-3-phenyl-propane-1-thiol | Drug Info | [525524] | |||
| (S)-2-Amino-4-methyl-pentane-1-thiol | Drug Info | [525524] | |||
| (S)-2-Amino-4-methylsulfanyl-butane-1-thiol | Drug Info | [525524] | |||
| (S)-2-Amino-4-phenyl-butane-1-thiol | Drug Info | [525524] | |||
| (S)-2-Amino-propane-1-thiol | Drug Info | [525524] | |||
| 1-aminobutylphosphonic acid | Drug Info | [530815] | |||
| 1-aminohexylphosphonic acid | Drug Info | [530815] | |||
| 1-aminohexylphosphonic acid monophenyl ester | Drug Info | [530815] | |||
| 1-aminopentylphosphonic acid monophenyl ester | Drug Info | [530815] | |||
| 2-amino-N1-benzyl-N3-hydroxymalonamide | Drug Info | [528703] | |||
| 2-benzyl-N1-hydroxy-N3-(3-phenylpropyl)malonamide | Drug Info | [528703] | |||
| 2-benzyl-N1-hydroxy-N3-(4-phenylbutyl)malonamide | Drug Info | [528703] | |||
| 2-benzyl-N1-hydroxy-N3-phenethylmalonamide | Drug Info | [528703] | |||
| 2-Cinnamamido-N1-hydroxy-N4-octylsuccinamide | Drug Info | [530409] | |||
| 2-Cinnamamido-N1-hydroxy-N4-pentylsuccinamide | Drug Info | [530409] | |||
| 2-Cinnamamido-N4-hexyl-N1-hydroxysuccinamide | Drug Info | [530409] | |||
| Angiotensin IV | Drug Info | [529535] | |||
| compound I3 | Drug Info | [532241] | |||
| IP10.C8-1 | Drug Info | [522549], [530043] | |||
| KELATORPHAN | Drug Info | [533380] | |||
| N-biphenyl-3-ylmethyl-N'-hydroxy-malonamide | Drug Info | [528703] | |||
| N-Hydroxy-2-(naphthalen-2-ylsulfanyl)-acetamide | Drug Info | [527322] | |||
| N1,2-dibenzyl-N3-hydroxy-N1-phenethylmalonamide | Drug Info | [528703] | |||
| N1,2-dibenzyl-N3-hydroxymalonamide | Drug Info | [528703] | |||
| N1-(3,3-diphenylpropyl)-N3-hydroxymalonamide | Drug Info | [528703] | |||
| N1-(3-phenoxybenzyl)-N3-hydroxymalonamide | Drug Info | [528703] | |||
| N1-(4-chlorobenzyl)-2-amino-N3-hydroxymalonamide | Drug Info | [528703] | |||
| N1-(4-chlorobenzyl)-2-benzyl-N3-hydroxymalonamide | Drug Info | [528703] | |||
| N1-(4-fluorobenzyl)-2-benzyl-N3-hydroxymalonamide | Drug Info | [528703] | |||
| N1-benzyl-N3-hydroxy-2-isobutylmalonamide | Drug Info | [528501] | |||
| N1-hydroxy-2-isobutyl-N3-phenethylmalonamide | Drug Info | [528501] | |||
| N4-Butyl-2-cinnamamido-N1-hydroxysuccinamide | Drug Info | [530409] | |||
| [(125)I] RB129 | Drug Info | [535925] | |||
| Modulator | IP10 C8 | Drug Info | [530043] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | Glutathione-mediated detoxification | ||||
| KEGG Pathway | Glutathione metabolism | ||||
| Metabolic pathways | |||||
| Renin-angiotensin system | |||||
| Hematopoietic cell lineage | |||||
| Pathway Interaction Database | C-MYB transcription factor network | ||||
| PathWhiz Pathway | Glutathione Metabolism | ||||
| Reactome | Metabolism of Angiotensinogen to Angiotensins | ||||
| WikiPathways | Metabolism of Angiotensinogen to Angiotensins | ||||
| Cardiac Progenitor Differentiation | |||||
| miR-targeted genes in squamous cell - TarBase | |||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in lymphocytes - TarBase | |||||
| miR-targeted genes in leukocytes - TarBase | |||||
| Glutathione metabolism | |||||
| References | |||||
| Ref 522549 | ClinicalTrials.gov (NCT00824980) Combined Inhibition of Dipeptidyl Peptidase IV (DPIV/CD26) and Aminopeptidase N (APN/CD13) in the Treatment of Psoriasis. U.S. National Institutes of Health. | ||||
| Ref 525524 | Bioorg Med Chem Lett. 1999 Jun 7;9(11):1511-6.Design of the first highly potent and selective aminopeptidase N (EC 3.4.11.2) inhibitor. | ||||
| Ref 527322 | Bioorg Med Chem Lett. 2005 Jan 3;15(1):181-3.N-hydroxy-2-(naphthalene-2-ylsulfanyl)-acetamide, a novel hydroxamic acid-based inhibitor of aminopeptidase N and its anti-angiogenic activity. | ||||
| Ref 528501 | Bioorg Med Chem. 2007 Jan 1;15(1):63-76. Epub 2006 Oct 12.A library of novel hydroxamic acids targeting the metallo-protease family: design, parallel synthesis and screening. | ||||
| Ref 528703 | J Med Chem. 2007 Mar 22;50(6):1322-34. Epub 2007 Feb 28.Novel selective inhibitors of the zinc plasmodial aminopeptidase PfA-M1 as potential antimalarial agents. | ||||
| Ref 529535 | Bioorg Med Chem. 2008 Jul 15;16(14):6924-35. Epub 2008 May 27.Ligands to the (IRAP)/AT4 receptor encompassing a 4-hydroxydiphenylmethane scaffold replacing Tyr2. | ||||
| Ref 530043 | Recent insights into the role of dipeptidyl aminopeptidase IV (DPIV) and aminopeptidase N (APN) families in immune functions. Clin Chem Lab Med. 2009;47(3):253-61. | ||||
| Ref 530409 | Bioorg Med Chem. 2009 Oct 15;17(20):7398-404. Epub 2009 Sep 24.Design, synthesis, and preliminary studies of the activity of novel derivatives of N-cinnamoyl-L-aspartic acid as inhibitors of aminopeptidase N/CD13. | ||||
| Ref 530815 | Bioorg Med Chem. 2010 Apr 15;18(8):2930-6. Epub 2010 Mar 1.New aromatic monoesters of alpha-aminoaralkylphosphonic acids as inhibitors of aminopeptidase N/CD13. | ||||
| Ref 532241 | Selective aminopeptidase-N (CD13) inhibitors with relevance to cancer chemotherapy. Bioorg Med Chem. 2013 Apr 1;21(7):2135-44. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

