Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T64567
|
||||
Former ID |
TTDR00211
|
||||
Target Name |
Carbonic anhydrase IX
|
||||
Gene Name |
CA9
|
||||
Synonyms |
CA-IX; CAIX; Carbonate dehydratase IX; G250 antigen (MN/CA IX/G250); Membrane antigen MN; P54/58N; PMW1; RCC-associated antigen G250; Renal cell carcinoma-associated antigen G250; CA9
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Clear cell renal cell carcinoma [ICD9: 189; ICD10: C64] | |||||
Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
Renal cancer [ICD9: 140-229, 189; ICD10: C64] | |||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Reversible hydration of carbon dioxide. Participates in pH regulation. May be involved in the control of cell proliferation and transformation. Appears to be a novel specific biomarker for a cervical neoplasia.
|
||||
BioChemical Class |
Carbon-oxygen lyases
|
||||
Target Validation |
T64567
|
||||
UniProt ID | |||||
EC Number |
EC 4.2.1.1
|
||||
Sequence |
MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPVHPQRLPRMQEDSPLGGGSSGEDDPL
GEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPG DPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPL ELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHT VEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIA EEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLS DTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGA |
||||
Drugs and Mode of Action | |||||
Drug(s) | MAFENIDE | Drug Info | Approved | Bacterial infection | [530765] |
Curcumin | Drug Info | Phase 3 | Cancer | [532348], [542031] | |
Girentuximab | Drug Info | Phase 3 | Clear cell renal cell carcinoma | [524178], [542901] | |
PARABEN | Drug Info | Phase 3 | Discovery agent | [524059] | |
PHENOL | Drug Info | Phase 2/3 | Discovery agent | [525296] | |
COUMATE | Drug Info | Phase 2 | Breast cancer | [531371] | |
Girentuximab I-124 | Drug Info | Phase 2 | Renal cancer | [522378] | |
INDISULAM | Drug Info | Phase 2 | Lymphoma | [521486], [542057] | |
90Y-cG250 | Drug Info | Phase 1 | Cancer | [521704] | |
BAY 79-4620 | Drug Info | Phase 1 | Solid tumours | [522886] | |
SULFAMIDE | Drug Info | Phase 1 | Discovery agent | [524873] | |
CA9-ADC | Drug Info | Discontinued in Phase 1 | Solid tumours | [549015] | |
SPERMINE | Drug Info | Terminated | Discovery agent | [542107], [546483] | |
Inhibitor | (2-bromophenyl)difluoromethanesulfonamide | Drug Info | [527782] | ||
(4-bromophenyl)difluoromethanesulfonamide | Drug Info | [527782] | |||
(4-sulfamoylphenylethylthioureido)fluorescein | Drug Info | [529381] | |||
1,4-Dihydro-1-methyl-4-oxo-3-pyridinesulfonamide | Drug Info | [530978] | |||
1,4-phenylene disulfamate | Drug Info | [529884] | |||
1-(3,4-dichlorophenyl)-3-hydroxyurea | Drug Info | [528240] | |||
1-acetamido-5-sulfonamidoindane | Drug Info | [528160] | |||
1-Benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide | Drug Info | [530978] | |||
1-cyclohexylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
1-pentafluorophenylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
1-valproylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
2,2,2-Trifluoro-N-(4-sulfamoyl-phenyl)-acetamide | Drug Info | [527743] | |||
2,2-Dimethyl-N-(4-sulfamoyl-phenyl)-propionamide | Drug Info | [527743] | |||
2,4-Disulfamyltrifluoromethylaniline | Drug Info | [529948] | |||
2-(4-chlorobenzyloxyamino)-N-hydroxyacetamide | Drug Info | [528653] | |||
2-(4-chlorobenzyloxyamino)-N-hydroxyhexanamide | Drug Info | [528653] | |||
2-(4-chlorobenzyloxyamino)-N-hydroxypropanamide | Drug Info | [528653] | |||
2-(benzyloxyamino)-N-hydroxy-3-methylpentanamide | Drug Info | [528653] | |||
2-(benzyloxyamino)-N-hydroxyacetamide | Drug Info | [528653] | |||
2-(benzyloxyamino)-N-hydroxyhexanamide | Drug Info | [528653] | |||
2-(N''-Acetyl-hydrazino)-benzenesulfonamide | Drug Info | [527482] | |||
2-acetamido-5-sulfonamidoindane | Drug Info | [528160] | |||
2-Amino-benzenesulfonamide | Drug Info | [529948] | |||
2-butylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
2-cyclohexylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
2-ethylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
2-Hydrazinocarbonyl-benzenesulfonamide | Drug Info | [527482] | |||
2-hydrazinylbenzenesulfonamide | Drug Info | [529948] | |||
2-Mercapto-N-(4-sulfamoyl-phenyl)-benzamide | Drug Info | [529381] | |||
2-Morpholin-4-yl-N-(4-sulfamoyl-phenyl)-acetamide | Drug Info | [527338] | |||
2-nonylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
2-oxo-2H-thiochromene-3-carboxylic acid | Drug Info | [530514] | |||
2-pentafluorophenylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
2-propylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
2-Sulfamoyl-benzoic acid methyl ester | Drug Info | [527482] | |||
2-valproylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
3-((4-aminophenyl)diazenyl)benzenesulfonamide | Drug Info | [530399] | |||
3-((4-hydroxyphenyl)diazenyl)benzenesulfonamide | Drug Info | [530399] | |||
3-(3-Phenyl-ureido)-benzenesulfonamide | Drug Info | [527743] | |||
3-(4'-Hydroxyphenyl)diazenylbenzenesulfonamide | Drug Info | [530399] | |||
3-Amino-benzenesulfonamide | Drug Info | [527654] | |||
3-bromophenyl-difluoromethanesulfonamide | Drug Info | [527782] | |||
3-Chloro-4-hydrazino-benzenesulfonamide | Drug Info | [527482] | |||
3-Fluoro-4-hydrazino-benzenesulfonamide | Drug Info | [527482] | |||
3-mercapto-N-(4-sulfamoyl-phenyl)-propionamide | Drug Info | [528406] | |||
4,4'-thiodipyridine-3-sulfonamide | Drug Info | [530766] | |||
4-((4-hydroxyphenyl)diazenyl)benzenesulfonamide | Drug Info | [530399] | |||
4-(2-Amino-ethyl)-benzenesulfonamide | Drug Info | [527645] | |||
4-(2-aminopyrimidin-4-ylamino)benzenesulfonamide | Drug Info | [529948] | |||
4-(2-Hydroxy-ethyl)-benzenesulfonamide | Drug Info | [529948] | |||
4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
4-(2-Propynylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
4-(4'-N-Methylphenyl)diazenylbenzenesulfonamide | Drug Info | [530399] | |||
4-(4-Cyanophenoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
4-(4-Fluorophenoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide | Drug Info | [530766] | |||
4-(Allylamino)-3-pyridinesulfonamide | Drug Info | [530766] | |||
4-(Carbamolymethylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
4-(Cyanomethylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
4-(hydroxymethyl)benzenesulfonamide | Drug Info | [529948] | |||
4-(Methylhydrazino)-3-pyridinesulfonamide | Drug Info | [530766] | |||
4-(N-Oxide-2-pyridylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
4-(Quinolinoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
4-Amino-3-bromo-benzenesulfonamide | Drug Info | [529948] | |||
4-Amino-3-chloro-benzenesulfonamide | Drug Info | [529948] | |||
4-Amino-3-fluoro-benzenesulfonamide | Drug Info | [529948] | |||
4-Amino-3-iodo-benzenesulfonamide | Drug Info | [529948] | |||
4-amino-6-chlorobenzene-1,3-disulfonamide | Drug Info | [529948] | |||
4-amino-N-(4-sulfamoylbenzyl)benzenesulfonamide | Drug Info | [529948] | |||
4-azidobenzenesulfonamide | Drug Info | [530020] | |||
4-Benzenesulfonylamino-benzenesulfonamide | Drug Info | [527743] | |||
4-Benzythiopyridine-3-sulfonamide | Drug Info | [530766] | |||
4-Ethoxy-3-pyridinesulfonamide | Drug Info | [530766] | |||
4-ethynyl benzene sulfonamide | Drug Info | [529344] | |||
4-fluoro-N-(4-sulfamoylbenzyl)benzenesulfonamide | Drug Info | [529884] | |||
4-Hydrazino-3-pyridinesulfonamide | Drug Info | [530766] | |||
4-Hydrazino-benzenesulfonamide | Drug Info | [529948] | |||
4-Hydrazinocarbonyl-benzenesulfonamide | Drug Info | [527482] | |||
4-Methanesulfonylamino-benzenesulfonamide | Drug Info | [527743] | |||
4-Methoxy-3-pyridinesulfonamide | Drug Info | [530766] | |||
4-methylphenyl-difluoromethanesulfonamide | Drug Info | [527782] | |||
4-Methylthiopyridine-3-sulfonamide | Drug Info | [530766] | |||
4-nitrophenyl-difluoromethanesulfonamide | Drug Info | [527782] | |||
4-[2-(3-Phenyl-ureido)-ethyl]-benzenesulfonamide | Drug Info | [527743] | |||
5-amino-1,3,4-thiadiazole-2-sulfonamide | Drug Info | [531013] | |||
5-Amino-[1,3,4]thiadiazole-2-thiol | Drug Info | [527519] | |||
6-(aminomethyl)-2H-chromen-2-one | Drug Info | [530514] | |||
6-(hydroxymethyl)-2H-chromen-2-one | Drug Info | [530514] | |||
6-Acetyl-7-ethoxy-2H-chromen-2-one | Drug Info | [531259] | |||
6-Acetyl-7-hydroxy-2H-chromen-2-one | Drug Info | [531259] | |||
6-acetyl-7-methoxy-2H-chromen-2-one | Drug Info | [531259] | |||
6-acetyl-7-propoxy-2H-chromen-2-one | Drug Info | [531259] | |||
6-Hydroxy-benzothiazole-2-sulfonic acid amide | Drug Info | [529948] | |||
6-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
6-methyl-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
7-(benzyloxy)-2H-chromen-2-one | Drug Info | [530514] | |||
7-butoxy-2H-chromen-2-one | Drug Info | [530514] | |||
7-ethoxy-8-propionyl-2H-chromen-2-one | Drug Info | [531259] | |||
7-hydroxy-6-propionyl-2H-chromen-2-one | Drug Info | [531259] | |||
7-hydroxy-8-propionyl-2H-chromen-2-one | Drug Info | [531259] | |||
7-methoxy-2-oxo-2H-chromene-4-carboxylic acid | Drug Info | [530514] | |||
7-methoxy-8-propionyl-2H-chromen-2-one | Drug Info | [531259] | |||
7-phenethoxy-2H-chromen-2-one | Drug Info | [530514] | |||
7-propoxy-2H-chromen-2-one | Drug Info | [530514] | |||
8-acetyl-7-(benzyloxy)-2H-chromen-2-one | Drug Info | [531259] | |||
8-acetyl-7-butoxy-2H-chromen-2-one | Drug Info | [531259] | |||
8-acetyl-7-ethoxy-2H-chromen-2-one | Drug Info | [531259] | |||
8-Acetyl-7-hydroxy-2H-chromen-2-one | Drug Info | [531259] | |||
8-acetyl-7-methoxy-2H-chromen-2-one | Drug Info | [531259] | |||
8-acetyl-7-propoxy-2H-chromen-2-one | Drug Info | [531259] | |||
8-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
8-Propionyl-7-propoxy-2H-chromen-2-one | Drug Info | [531259] | |||
ACETYLSULFANILAMIDE | Drug Info | [527743] | |||
Aminobenzolamide derivative | Drug Info | [527261] | |||
Azide | Drug Info | [527260] | |||
BENZOLAMIDE | Drug Info | [529948] | |||
BICARBONATE | Drug Info | [527389] | |||
Carzenide | Drug Info | [529948] | |||
CATECHIN | Drug Info | [531068] | |||
COUMARIN | Drug Info | [530514] | |||
COUMATE | Drug Info | [529605] | |||
Curcumin | Drug Info | [531068] | |||
Decane-1,10-diyl disulfamate | Drug Info | [530359] | |||
Decyl sulfamate | Drug Info | [530359] | |||
ELLAGIC ACID | Drug Info | [530751] | |||
ETHOXYCOUMARIN | Drug Info | [530514] | |||
Ethyl 7-methoxy-2-oxo-2H-chromene-3-carboxylate | Drug Info | [530514] | |||
FERULIC ACID | Drug Info | [530751] | |||
GALLICACID | Drug Info | [530751] | |||
HERNIARIN | Drug Info | [530514] | |||
Hexane-1,6-diamine | Drug Info | [530998] | |||
HYDROSULFIDE | Drug Info | [527260] | |||
MAFENIDE | Drug Info | [530765] | |||
MMI270 | Drug Info | [528653] | |||
N-(4-cyanophenyl)sulfamide | Drug Info | [527520] | |||
N-(4-Sulfamoyl-phenyl)-benzamide | Drug Info | [527743] | |||
N-(4-Sulfamoyl-phenyl)-butyramide | Drug Info | [527743] | |||
N-(4-Sulfamoyl-phenyl)-isobutyramide | Drug Info | [527743] | |||
N-(4-Sulfamoyl-phenyl)-propionamide | Drug Info | [527743] | |||
N-(4-sulfamoylphenylethyl)-4-sulfamoylbenzamide | Drug Info | [551223] | |||
N-(5-Mercapto-[1,3,4]thiadiazol-2-yl)-acetamide | Drug Info | [527519] | |||
N-(pentafluorophenyl)sulfamide | Drug Info | [527520] | |||
N-hydroxysulfamide | Drug Info | [530922] | |||
N-propynyl amidebenzenesulphonide | Drug Info | [528491] | |||
N1-(2-aminoethyl)ethane-1,2-diamine | Drug Info | [530998] | |||
N1-(naphthalen-1-yl)ethane-1,2-diamine | Drug Info | [530998] | |||
NSC-654077 | Drug Info | [529381] | |||
Octane-1,8-diyl disulfamate | Drug Info | [530359] | |||
Octyl sulfamate | Drug Info | [530359] | |||
P-Coumaric Acid | Drug Info | [530751] | |||
P-TOLUENESULFONAMIDE | Drug Info | [529948] | |||
PARABEN | Drug Info | [530751] | |||
Pentane-1,5-diamine | Drug Info | [530998] | |||
Pentanoic acid (4-sulfamoyl-phenyl)-amide | Drug Info | [527743] | |||
PHENOL | Drug Info | [531068] | |||
PHENYLDIFLUOROMETHANESULFONAMIDE | Drug Info | [527782] | |||
PHENYLMETHANESULFONAMIDE | Drug Info | [527782] | |||
PHENYLSULFAMATE | Drug Info | [527782] | |||
Prop-2-ynyl 4-sulfamoylbenzoate | Drug Info | [528491] | |||
Quinoline-8-sulfonamide | Drug Info | [529884] | |||
SACCHARIN | Drug Info | [529179] | |||
Sodium N-methylphenylaminomethanesulfonate | Drug Info | [530399] | |||
Sodium phenylaminomethanesulfonate | Drug Info | [530399] | |||
SPERMINE | Drug Info | [530998] | |||
SULFAMATE | Drug Info | [527389] | |||
Sulfamic acid 12-sulfamoyloxy-dodecyl ester | Drug Info | [527391] | |||
Sulfamic acid 16-sulfamoyloxy-hexadecyl ester | Drug Info | [527391] | |||
Sulfamic acid 3-sulfamoyloxy-phenyl ester | Drug Info | [527391] | |||
Sulfamic acid 4-sulfamoyloxy-butyl ester | Drug Info | [527391] | |||
Sulfamic acid 4-sulfamoyloxymethyl-benzyl ester | Drug Info | [527391] | |||
Sulfamic acid 6-sulfamoyloxy-hexyl ester | Drug Info | [527391] | |||
Sulfamic acid 7-sulfamoyloxy-heptyl ester | Drug Info | [527391] | |||
SULFAMIDE | Drug Info | [527389] | |||
Sulfanilamide derivative | Drug Info | [527560] | |||
Syringic Acid | Drug Info | [530751] | |||
UMBELLIFERONE | Drug Info | [531259] | |||
Enhancer | Girentuximab I-124 | Drug Info | [532138], [532748] | ||
Modulator | INDISULAM | Drug Info | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Nitrogen metabolism | ||||
Pathway Interaction Database | HIF-1-alpha transcription factor network | ||||
Reactome | Regulation of gene expression by Hypoxia-inducible Factor | ||||
Reversible hydration of carbon dioxide | |||||
WikiPathways | Vitamin D Receptor Pathway | ||||
Reversible Hydration of Carbon Dioxide | |||||
Regulation of Hypoxia-inducible Factor (HIF) by Oxygen | |||||
References | |||||
Ref 521486 | ClinicalTrials.gov (NCT00014625) E7070 in Treating Patients With Stage IV Melanoma. U.S. National Institutes of Health. | ||||
Ref 521704 | ClinicalTrials.gov (NCT00199875) Treatment of Patients With Advanced Renal Cancer With a Radio-labeled Antibody, Yttrium-90 Conjugated Chimeric G250. U.S. National Institutes of Health. | ||||
Ref 522378 | ClinicalTrials.gov (NCT00717587) Sunitinib Before and After Surgery in Treating Patients With Stage IV Kidney Cancer. U.S. National Institutes of Health. | ||||
Ref 522886 | ClinicalTrials.gov (NCT01028755) To Determine Maximum Tolerated Dose of BAY79-4620 in Patients With Advanced Solid Tumors. U.S. National Institutes of Health. | ||||
Ref 524059 | ClinicalTrials.gov (NCT01688479) Trial Comparing Calendula Officinalis With Aqueous Cream "Essex" to Treat Skin Reactions From Radiotherapy of Breast Cancer. U.S. National Institutes of Health. | ||||
Ref 524178 | ClinicalTrials.gov (NCT01762592) REDECT 2: REnal Masses: Pivotal Trial to DEteCT Clear Cell Renal Cell Carcinoma With PET/CT. U.S. National Institutes of Health. | ||||
Ref 524873 | ClinicalTrials.gov (NCT02216669) Trial to Determine Optimal Phase II Dose of the Oral Dual CAIX Inhibitor/ Radiosensitizer. U.S. National Institutes of Health. | ||||
Ref 525296 | ClinicalTrials.gov (NCT02527187) Determination of the Sensitivity and Specificity of Prick Test Betula Verrucosa. | ||||
Ref 530765 | J Med Chem. 2010 Apr 8;53(7):2913-26.Sulfonamide linked neoglycoconjugates--a new class of inhibitors for cancer-associated carbonic anhydrases. | ||||
Ref 531371 | Irosustat: a first-generation steroid sulfatase inhibitor in breast cancer. Expert Rev Anticancer Ther. 2011 Feb;11(2):179-83. | ||||
Ref 532348 | Nanocurcumin: a promising therapeutic advancement over native curcumin. Crit Rev Ther Drug Carrier Syst. 2013;30(4):331-68. | ||||
Ref 542031 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7000). | ||||
Ref 542057 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7046). | ||||
Ref 542107 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 710). | ||||
Ref 542901 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7987). | ||||
Ref 527260 | Bioorg Med Chem Lett. 2004 Dec 6;14(23):5769-73.Carbonic anhydrase inhibitors: inhibition of the membrane-bound human isozyme IV with anions. | ||||
Ref 527261 | Bioorg Med Chem Lett. 2004 Dec 6;14(23):5775-80.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides derived from 4-isothiocyanato-benzolamide. | ||||
Ref 527338 | Bioorg Med Chem Lett. 2005 Jan 17;15(2):367-72.Carbonic anhydrase inhibitors. Novel sulfanilamide/acetazolamide derivatives obtained by the tail approach and their interaction with the cytosolic isozymes I and II, and the tumor-associated isozyme IX. | ||||
Ref 527389 | Bioorg Med Chem Lett. 2005 Feb 1;15(3):567-71.Carbonic anhydrase inhibitors. Inhibition of isozymes I, II, IV, V, and IX with anions isosteric and isoelectronic with sulfate, nitrate, and carbonate. | ||||
Ref 527391 | Bioorg Med Chem Lett. 2005 Feb 1;15(3):579-84.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with bis-sulfamates. | ||||
Ref 527482 | J Med Chem. 2005 Mar 24;48(6):2121-5.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/membrane-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides incorporatinghydrazino moieties. | ||||
Ref 527519 | Bioorg Med Chem Lett. 2005 May 2;15(9):2347-52.Carbonic anhydrase inhibitors. Inhibition of the cytosolic and tumor-associated carbonic anhydrase isozymes I, II, and IX with a series of 1,3,4-thiadiazole- and 1,2,4-triazole-thiols. | ||||
Ref 527520 | Bioorg Med Chem Lett. 2005 May 2;15(9):2353-8.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with N-hydroxysulfamides--a new zinc-binding function in the design of inhibitors. | ||||
Ref 527560 | Bioorg Med Chem Lett. 2005 Jun 15;15(12):3096-101.Carbonic anhydrase inhibitors. Inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with Schiff's bases incorporating chromone and aromatic sulfonamide moieties, and their zinc complexes. | ||||
Ref 527645 | J Med Chem. 2005 Jul 28;48(15):4834-41.Carbonic anhydrase inhibitors. Design of fluorescent sulfonamides as probes of tumor-associated carbonic anhydrase IX that inhibit isozyme IX-mediated acidification of hypoxic tumors. | ||||
Ref 527654 | Bioorg Med Chem Lett. 2005 Sep 1;15(17):3828-33.Carbonic anhydrase inhibitors: inhibition of the transmembrane isozyme XIV with sulfonamides. | ||||
Ref 527743 | Bioorg Med Chem Lett. 2005 Nov 1;15(21):4862-6.Carbonic anhydrase inhibitors: inhibition of the tumor-associated isozymes IX and XII with a library of aromatic and heteroaromatic sulfonamides. | ||||
Ref 527782 | Bioorg Med Chem Lett. 2005 Dec 1;15(23):5192-6. Epub 2005 Oct 3.Carbonic anhydrase inhibitors: inhibition of the human isozymes I, II, VA, and IX with a library of substituted difluoromethanesulfonamides. | ||||
Ref 528160 | J Med Chem. 2006 May 4;49(9):2743-9.Indanesulfonamides as carbonic anhydrase inhibitors. Toward structure-based design of selective inhibitors of the tumor-associated isozyme CA IX. | ||||
Ref 528240 | Bioorg Med Chem Lett. 2006 Aug 15;16(16):4316-20. Epub 2006 Jun 12.N-hydroxyurea--a versatile zinc binding function in the design of metalloenzyme inhibitors. | ||||
Ref 528406 | J Med Chem. 2006 Sep 7;49(18):5544-51.Carbonic anhydrase inhibitors: Hypoxia-activatable sulfonamides incorporating disulfide bonds that target the tumor-associated isoform IX. | ||||
Ref 528491 | J Med Chem. 2006 Nov 2;49(22):6539-48.A novel class of carbonic anhydrase inhibitors: glycoconjugate benzene sulfonamides prepared by "click-tailing". | ||||
Ref 528653 | Bioorg Med Chem. 2007 Mar 15;15(6):2298-311. Epub 2007 Jan 19.Carbonic anhydrase and matrix metalloproteinase inhibitors. Inhibition of human tumor-associated isozymes IX and cytosolic isozyme I andII with sulfonylated hydroxamates. | ||||
Ref 529179 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):836-41. Epub 2007 Nov 13.Carbonic anhydrase inhibitors: copper(II) complexes of polyamino-polycarboxylamido aromatic/heterocyclic sulfonamides are very potentinhibitors of the tumor-associated isoforms IX and XII. | ||||
Ref 529344 | J Med Chem. 2008 Mar 27;51(6):1945-53. Epub 2008 Feb 29.Inhibition of carbonic anhydrases with glycosyltriazole benzene sulfonamides. | ||||
Ref 529381 | J Med Chem. 2008 Jun 12;51(11):3051-6. Epub 2008 Mar 19.Recent developments of carbonic anhydrase inhibitors as potential anticancer drugs. | ||||
Ref 529605 | Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. Epub 2008 Jul 5.Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-ray crystallographic studies. | ||||
Ref 529884 | Bioorg Med Chem. 2009 Jan 15;17(2):553-7. Epub 2008 Dec 6.Ligand-based and structure-based virtual screening to identify carbonic anhydrase IX inhibitors. | ||||
Ref 529948 | J Med Chem. 2009 Feb 12;52(3):646-54.Cloning, expression, post-translational modifications and inhibition studies on the latest mammalian carbonic anhydrase isoform, CA XV. | ||||
Ref 530020 | Bioorg Med Chem Lett. 2009 Apr 15;19(8):2273-6. Epub 2009 Feb 26.Inhibition of carbonic anhydrase isozymes with benzene sulfonamides incorporating thio, sulfinyl and sulfonyl glycoside moieties. | ||||
Ref 530359 | J Med Chem. 2009 Oct 8;52(19):5990-8.Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors. | ||||
Ref 530399 | Bioorg Med Chem. 2009 Oct 15;17(20):7093-9. Epub 2009 Sep 6.Carbonic anhydrase inhibitors. Diazenylbenzenesulfonamides are potent and selective inhibitors of the tumor-associated isozymes IX and XIIover the cytosolic isoforms I and II. | ||||
Ref 530514 | J Med Chem. 2010 Jan 14;53(1):335-44.Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. | ||||
Ref 530751 | Bioorg Med Chem. 2010 Mar 15;18(6):2159-64. Epub 2010 Feb 6.Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. | ||||
Ref 530765 | J Med Chem. 2010 Apr 8;53(7):2913-26.Sulfonamide linked neoglycoconjugates--a new class of inhibitors for cancer-associated carbonic anhydrases. | ||||
Ref 530766 | Eur J Med Chem. 2010 Jun;45(6):2396-404. Epub 2010 Feb 12.Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associated) and XIV with 4-substituted 3-pyridinesulfonamides. | ||||
Ref 530922 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5. Epub 2010 Apr 28.Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mammalian isoforms I-XV. | ||||
Ref 530978 | Eur J Med Chem. 2010 Sep;45(9):3656-61. Epub 2010 May 12.Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the human cytosolic isozymes I and II and transmembrane cancer-associated isozymes IX and XII. | ||||
Ref 530998 | J Med Chem. 2010 Aug 12;53(15):5511-22.Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. | ||||
Ref 531013 | Bioorg Med Chem Lett. 2010 Aug 1;20(15):4376-81. Epub 2010 Jun 17.Carbonic anhydrase inhibitors. The X-ray crystal structure of human isoform II in adduct with an adamantyl analogue of acetazolamideresides in a less utilized binding pocket than most hydrophobic inhibitors. | ||||
Ref 531068 | Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. Epub 2010 Jul 13.Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. | ||||
Ref 531259 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7255-8. Epub 2010 Oct 25.7,8-disubstituted- but not 6,7-disubstituted coumarins selectively inhibit the transmembrane, tumor-associated carbonic anhydrase isoforms IX and XII over the cytosolic ones I and II in the low nanomolar/subnanomolar range. | ||||
Ref 531730 | Therapeutic mechanism and efficacy of the antibody-drug conjugate BAY 79-4620 targeting human carbonic anhydrase 9. Mol Cancer Ther. 2012 Feb;11(2):340-9. | ||||
Ref 532138 | Potential role of (124)I-girentuximab in the presurgical diagnosis of clear-cell renal cell cancer. Biologics. 2012;6:395-407. | ||||
Ref 532393 | Application of monoclonal antibody G250 recognizing carbonic anhydrase IX in renal cell carcinoma. Int J Mol Sci. 2013 May 29;14(6):11402-23. | ||||
Ref 532748 | Optical Imaging of Renal Cell Carcinoma with Anti-Carbonic Anhydrase IX Monoclonal Antibody Girentuximab. J Nucl Med. 2014 Jun;55(6):1035-40. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.