Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T29339
|
||||
| Former ID |
TTDI02051
|
||||
| Target Name |
Retinoic acid-inducible gene-1 (RIG-1)
|
||||
| Gene Name |
DDX58
|
||||
| Synonyms |
DEAD box protein 58; Probable ATPdependent RNA helicase DDX58; RIG1; RIGI; RIGIlike receptor 1; RLR1; Retinoic acidinducible gene 1 protein; Retinoic acidinducible gene I protein; DDX58
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | HBV infection [ICD9: 070.2-070.3; ICD10: B16, B18.0, B18.1] | ||||
| Function |
Innate immune receptor which acts as a cytoplasmic sensor of viral nucleic acids and plays a major role in sensing viral infection and in the activation of a cascade of antiviral responses including the induction of type I interferons and proinflammatory cytokines. Its ligands include: 5'- triphosphorylated ssRNA and dsRNA and short dsRNA (<1 kb in length). In addition to the 5'-triphosphate moiety, blunt-end base pairing at the5'-end of the RNA is very essential. Overhangs at the non-triphosphorylated end of the dsRNA RNA have no major impact on its activity. A 3'overhang at the 5'triphosphate end decreases and any 5'overhang at the 5' triphosphate end abolishes its activity. Upon ligand binding it associates with mitochondria antiviral signaling protein (MAVS/IPS1) which activates the IKK- related kinases: TBK1 and IKBKE which phosphorylate interferon regulatory factors: IRF3 and IRF7 which in turn activate transcription of antiviral immunological genes, including interferons (IFNs); IFN-alpha and IFN-beta. Detects both positive and negative strand RNA viruses including members of the families Paramyxoviridae: Human respiratory syncytial virus and measles virus (MeV), Rhabdoviridae: vesicular stomatitis virus (VSV), Orthomyxoviridae: influenza A and B virus, Flaviviridae: Japanese encephalitis virus (JEV), hepatitis C virus (HCV), dengue virus (DENV) and west Nile virus (WNV). It also detects rotavirus andreovirus. Also involved in antiviral signaling in response to viruses containing a dsDNA genome such as Epstein-Barr virus (EBV). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). May play important roles in granulocyte production and differentiation, bacterial phagocytosis and in the regulation of cell migration.
|
||||
| BioChemical Class |
Acid anhydrides hydrolase
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.6.4.13
|
||||
| Sequence |
MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKF
LLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIP TDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERN KFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSP FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQI PVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTI PSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNT DEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMR DTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFL YTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESV SRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGI LTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGN VIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKI LHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKE CFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATG VQTLYSKWKDFHFEKIPFDPAEMSK |
||||
| Drugs and Mode of Action | |||||
| Modulator | SB-9200 | Drug Info | |||
| Pathways | |||||
| KEGG Pathway | NF-kappa B signaling pathway | ||||
| RIG-I-like receptor signaling pathway | |||||
| Cytosolic DNA-sensing pathway | |||||
| Hepatitis C | |||||
| Hepatitis B | |||||
| Measles | |||||
| Influenza A | |||||
| Herpes simplex infection | |||||
| Epstein-Barr virus infection | |||||
| Reactome | ISG15 antiviral mechanism | ||||
| TRAF3-dependent IRF activation pathway | |||||
| TRAF6 mediated IRF7 activation | |||||
| TRAF6 mediated NF-kB activation | |||||
| NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10 | |||||
| Negative regulators of RIG-I/MDA5 signaling | |||||
| WikiPathways | RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways | ||||
| References | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

