Target General Infomation
Target ID
T18972
Former ID
TTDNC00504
Target Name
CD3
Gene Name
CD3G
Synonyms
CD3g; T-cell receptor T3 gamma chain; T-cell surface glycoprotein CD3 gamma chain; CD3G
Target Type
Clinical Trial
Disease Advanced breast cancer [ICD9: 174, 175; ICD10: C50]
Breast cancer [ICD9: 174, 175; ICD10: C50]
Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21]
Gastrointestinal adenocarcinoma [ICD10: C15-C26]
Non-hodgkin's lymphoma [ICD10: C85]
Prostate cancer [ICD9: 185; ICD10: C61]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Function
The CD3 complex mediates signal transduction.
UniProt ID
Sequence
MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGK
MIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLF
AEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLR
RN
Drugs and Mode of Action
Drug(s) Ertumaxomab Drug Info Phase 2 Breast cancer [529707], [531972]
AFM11 Drug Info Phase 1 Non-hodgkin's lymphoma [524703]
Autologous T-cell therapy Drug Info Phase 1 Prostate cancer [525412]
Ertumaxomab Drug Info Phase 1 Advanced breast cancer [889343]
MEDI-565 Drug Info Phase 1 Gastrointestinal adenocarcinoma [523334]
MGD007 Drug Info Phase 1 Colorectal cancer [889404]
MT-110 Drug Info Phase 1 Solid tumours [531707]
Modulator AFM11 Drug Info [889442]
MEDI-565 Drug Info [889442]
MGD007 Drug Info [889442]
Pathways
KEGG Pathway Hematopoietic cell lineage
T cell receptor signaling pathway
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
NetPath Pathway TCR Signaling Pathway
PANTHER Pathway T cell activation
Pathway Interaction Database TCR signaling in na&amp
#xef
ve CD4+ T cells
IL12-mediated signaling events
TCR signaling in na&amp
ve CD8+ T cells
CXCR4-mediated signaling events
Downstream signaling in na&amp
IL12 signaling mediated by STAT4
Reactome Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
FCGR activation
Regulation of actin dynamics for phagocytic cup formation
Role of phospholipids in phagocytosis
PD-1 signaling
WikiPathways TCR Signaling Pathway
Fcgamma receptor (FCGR) dependent phagocytosis
TCR signaling
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Costimulation by the CD28 family
References
Ref 523334ClinicalTrials.gov (NCT01284231) A Study to Evaluate the Safety and Tolerability of MEDI-565 in Adults With Gastrointestinal Adenocarcinomas. U.S. National Institutes of Health.
Ref 524703ClinicalTrials.gov (NCT02106091) Safety Study to Assess AFM11 in Patients With Relapsed and/or Refractory CD19 Positive B-cell NHL or B-precursor ALL. U.S. National Institutes of Health.
Ref 525412Clinical application of genetically modified T cells in cancer therapy. Clin Transl Immunology. 2014 May 16;3(5):e16. doi: 10.1038/cti.2014.7. eCollection 2014.
Ref 529707Ertumaxomab: a trifunctional antibody for breast cancer treatment. Expert Opin Investig Drugs. 2008 Oct;17(10):1553-8.
Ref 531707EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74.
Ref 531972Trifunctional antibody ertumaxomab: Non-immunological effects on Her2 receptor activity and downstream signaling. MAbs. 2012 Sep-Oct;4(5):614-22.
Ref 889343ClinicalTrials.gov (NCT00452140) Phase II Study With the Trifunctional Antibody Ertumaxomab to Treat Metastatic Breast Cancer Progressing After Endocrine Treatment
Ref 889404ClinicalTrials.gov (NCT02248805) Phase 1 Study of MGD007 in Relapsed/Refractory Metastatic Colorectal Carcinoma
Ref 529707Ertumaxomab: a trifunctional antibody for breast cancer treatment. Expert Opin Investig Drugs. 2008 Oct;17(10):1553-8.
Ref 531707EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74.
Ref 531972Trifunctional antibody ertumaxomab: Non-immunological effects on Her2 receptor activity and downstream signaling. MAbs. 2012 Sep-Oct;4(5):614-22.
Ref 532162Antitumor activities of PSMA?CD3 diabodies by redirected T-cell lysis of prostate cancer cells. Immunotherapy. 2013 Jan;5(1):27-38.
Ref 889442Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801. doi: 10.1038/nrd4478.

If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.