Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T63083
|
||||
| Former ID |
TTDR00922
|
||||
| Target Name |
DNA repair protein RAD51 homolog 1
|
||||
| Gene Name |
RAD51
|
||||
| Synonyms |
HRAD51; HsRAD51; RAD51
|
||||
| Target Type |
Research
|
||||
| Function |
Participates in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. Underwinds duplex DNA and forms helical nucleoprotein filaments. Part of a PALB2- scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role inDNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3.
|
||||
| BioChemical Class |
DNA repair
|
||||
| UniProt ID | |||||
| Sequence |
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD |
||||
| Pathways | |||||
| KEGG Pathway | Homologous recombination | ||||
| Fanconi anemia pathway | |||||
| Pathways in cancer | |||||
| Pancreatic cancer | |||||
| Pathway Interaction Database | p73 transcription factor network | ||||
| ATR signaling pathway | |||||
| BARD1 signaling events | |||||
| Reactome | HDR through Single Strand Annealing (SSA) | ||||
| HDR through Homologous Recombination (HRR) | |||||
| Presynaptic phase of homologous DNA pairing and strand exchange | |||||
| Meiotic recombination | |||||
| WikiPathways | DNA Damage Response | ||||
| Meiotic Recombination | |||||
| ATM Signaling Pathway | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| Integrated Breast Cancer Pathway | |||||
| Homologous recombination | |||||
| Double-Strand Break Repair | |||||
| miRNA Regulation of DNA Damage Response | |||||
| References | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

