Target General Infomation
Target ID
T25005
Former ID
TTDR00233
Target Name
Tyrosine-protein kinase BTK
Gene Name
BTK
Synonyms
ATK; Agammaglobulinaemia tyrosine kinase; B cell progenitor kinase; BPK; Bruton's tyrosine kinase; BTK
Target Type
Successful
Disease Autoimmune diabetes [ICD10: E08-E13]
B-cell lymphoma [ICD9: 202.8; ICD10: C85.1]
Chronic lymphocytic leukaemia [ICD10: C91]
Chronic lymphocytic leukaemia; Refractory or relapsed mantle cell lymphoma [ICD9:200.4; ICD10: C91, C85.7]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Function
Non-receptor tyrosine kinase indispensable for B lymphocyte development, differentiation and signaling. Binding of antigen to the B-cell antigen receptor (BCR) triggers signaling that ultimately leads to B-cell activation. After BCRengagement and activation at the plasma membrane, phosphorylates PLCG2 at several sites, igniting the downstream signaling pathway through calcium mobilization, followed by activation of the protein kinase C (PKC) family members. PLCG2 phosphorylation is performed in close cooperation with the adapter protein B-cell linker protein BLNK. BTK acts as a platform to bring together a diverse array of signaling proteins and is implicated in cytokine receptor signaling pathways. Plays an important role in the function of immune cells of innate as well as adaptive immunity, as a component of the Toll-like receptors (TLR) pathway. The TLR pathway acts as a primary surveillance system for the detection of pathogens and are crucial to the activation of host defense. Especially, is a critical molecule in regulating TLR9 activation in splenic B-cells. Within the TLR pathway, induces tyrosine phosphorylation of TIRAP which leads to TIRAP degradation. BTK plays also a critical role in transcription regulation. Induces the activity of NF-kappa-B, which is involved in regulating the expression of hundreds of genes. BTK is involved on the signaling pathway linking TLR8 and TLR9 to NF-kappa-B. Transiently phosphorylates transcription factor GTF2I on tyrosine residues in response to BCR. GTF2I then translocates to the nucleus to bind regulatory enhancer elements to modulate gene expression. ARID3A and NFAT are other transcriptional target of BTK. BTK is required for the formation of functional ARID3A DNA-binding complexes. There is however no evidence that BTK itself binds directly to DNA. BTK has a dual role in the regulation of apoptosis.
BioChemical Class
Kinase
Target Validation
T25005
UniProt ID
EC Number
EC 2.7.10.2
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
Drugs and Mode of Action
Drug(s) Ibrutinib Drug Info Approved Chronic lymphocytic leukaemia; Refractory or relapsed mantle cell lymphoma [524263], [541962], [551043]
Ibrutinib companion diagnostic Drug Info Approved Chronic lymphocytic leukaemia [551871]
ACP-196 Drug Info Phase 3 Chronic lymphocytic leukaemia [525235]
CC-292 Drug Info Phase 2 Chronic lymphocytic leukaemia [532375]
ACP-319 Drug Info Phase 1/2 Chronic lymphocytic leukaemia [549565]
ONO-4059 Drug Info Phase 1 B-cell lymphoma [524010]
PCI-45292 Drug Info Preclinical Autoimmune diabetes [548870]
GDC-0834 Drug Info Terminated Rheumatoid arthritis [531450]
Inhibitor ACP-196 Drug Info [550507]
ACP-319 Drug Info [543527]
CGI-1316 Drug Info [543527]
compound 2c Drug Info [532818]
compound 31 Drug Info [532836]
compound 38 Drug Info [532836]
GDC-0834 Drug Info [531450]
Ibrutinib Drug Info [543527]
Ibrutinib companion diagnostic Drug Info [532183]
Inositol 1,3,4,5-Tetrakisphosphate Drug Info [551393]
LFM-A13 Drug Info [529213]
PCI-45292 Drug Info [544344]
RN486 Drug Info [531761]
Modulator CC-292 Drug Info [532375]
ONO-4059 Drug Info [549764]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
DRM DRM Info
Pathways
KEGG Pathway NF-kappa B signaling pathway
Osteoclast differentiation
Platelet activation
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Primary immunodeficiency
PANTHER Pathway B cell activation
Pathway Interaction Database Fc-epsilon receptor I signaling in mast cells
BCR signaling pathway
FAS (CD95) signaling pathway
Class I PI3K signaling events
EPO signaling pathway
PathWhiz Pathway Fc Epsilon Receptor I Signaling in Mast Cells
Reactome Mal cascade initiated on plasma membrane
Regulation of actin dynamics for phagocytic cup formation
DAP12 signaling
FCERI mediated Ca+2 mobilization
MyD88 deficiency (TLR2/4)
IRAK4 deficiency (TLR2/4)
RHO GTPases Activate WASPs and WAVEs
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
WikiPathways Kit receptor signaling pathway
Mal cascade initiated on plasma membrane
Signaling by the B Cell Receptor (BCR)
DAP12 interactions
B Cell Receptor Signaling Pathway
TSLP Signaling Pathway
Regulation of toll-like receptor signaling pathway
IL-5 Signaling Pathway
References
Ref 524010ClinicalTrials.gov (NCT01659255) Phase I Study of ONO-4059 Given as Monotherapy in Patients With Relapsed/Refractory NHL and CLL. U.S. National Institutes of Health.
Ref 524263ClinicalTrials.gov (NCT01833039) An Open Label Treatment Use Protocol for Ibrutinib in Subjects With Relapsed or Refractory Mantle Cell Lymphoma. U.S. National Institutes of Health.
Ref 525235ClinicalTrials.gov (NCT02475681) Study of Obinutuzumab + Chlorambucil, ACP-196 + Obinutuzumab, and ACP-196 in Subjects With Previously Untreated CLL.
Ref 531450Antiarthritis effect of a novel Bruton's tyrosine kinase (BTK) inhibitor in rat collagen-induced arthritis and mechanism-based pharmacokinetic/pharmacodynamic modeling: relationships between inhibition of BTK phosphorylation and efficacy. J Pharmacol Exp Ther. 2011 Jul;338(1):154-63.
Ref 532375Inhibition of Btk with CC-292 provides early pharmacodynamic assessment of activity in mice and humans. J Pharmacol Exp Ther. 2013 Aug;346(2):219-28.
Ref 541962(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6912).
Ref 548870Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029717)
Ref 549565Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040955)
Ref 551043Janssen's IMBRUVICA (ibrutinib) Receives Additional European Commission Approval for the Treatment of Waldenstrom's Macroglobulinemia. Janssen-Cilag International NV (Janssen). Jul 10, 2015.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 529213Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20523-8. Epub 2007 Dec 11.A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases.
Ref 531450Antiarthritis effect of a novel Bruton's tyrosine kinase (BTK) inhibitor in rat collagen-induced arthritis and mechanism-based pharmacokinetic/pharmacodynamic modeling: relationships between inhibition of BTK phosphorylation and efficacy. J Pharmacol Exp Ther. 2011 Jul;338(1):154-63.
Ref 531761RN486, a selective Bruton's tyrosine kinase inhibitor, abrogates immune hypersensitivity responses and arthritis in rodents. J Pharmacol Exp Ther. 2012 Apr;341(1):90-103.
Ref 532183Ibrutinib (PCI-32765), the first BTK (Bruton's tyrosine kinase) inhibitor in clinical trials. Curr Hematol Malig Rep. 2013 Mar;8(1):1-6.
Ref 532375Inhibition of Btk with CC-292 provides early pharmacodynamic assessment of activity in mice and humans. J Pharmacol Exp Ther. 2013 Aug;346(2):219-28.
Ref 532818Discovery of Disubstituted Imidazo[4,5-b]pyridines and Purines as Potent TrkA Inhibitors. ACS Med Chem Lett. 2012 Jul 26;3(9):705-9.
Ref 532836Discovery of a series of 2,5-diaminopyrimidine covalent irreversible inhibitors of Bruton's tyrosine kinase with in vivo antitumor activity. J Med Chem. 2014 Jun 26;57(12):5112-28.
Ref 543527(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1948).
Ref 544344Ibrutinib is an irreversible molecular inhibitor of ITK driving a Th1-selective pressure in T lymphocytes. Blood. 2013 October 10; 122(15): 2539-2549.
Ref 549764ONO-4059, a novel oral Bruton's tyrosine kinase (Btk) inhibitor that demonstrates potent pharmacodynamic activity through Phosphorylated Btk (P-Btk) inhibition, in addition to effective anti-tumour activity in a TMD-8 (DLBCL) xenograft model. Cancer Research. 08/2013; 73(8 Supplement):2452-2452.
Ref 550507National Cancer Institute Drug Dictionary (drug id 756623).
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.